• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
MoFlo Fluorescence Resonance Energy Transfer E T
MoFlo Fluorescence Resonance Energy Transfer E T

... (PMT) settings and determining a live-cell gate using light scatter. 2. A CFP-only transfectant. This sample is used to fine tune PMT settings and to monitor spectral bleed-over into the YFP and FRET detectors. 3. A YFP-only transfectant. This sample is again used to fine tune PMT settings and t ...
Abstract Print View - Synthetic Neurobiology Group
Abstract Print View - Synthetic Neurobiology Group

... behavioral and physiological visual function is restored in the adult rd1 mouse when ChR2 expression is genetically-targeted to the ON bipolar cells using the GRM6 promoter, and delivered using an adeno-associated virus (AAV). Methods: We evaluated retinal bipolar cell transduction using wild-type a ...
Cloning vectors for the expression of green fluorescent protein
Cloning vectors for the expression of green fluorescent protein

... the antibody to the antigen. Compared with the aforementioned techniques, GFP-based detection has the advantage that living cells can be examined, allowing real-time imaging, and avoiding fixation artifacts. Moreover, many plant tissues are easily transformable and exhibit little green autofluoresce ...
Visualizing the actin cytoskeleton in living plant cells using a photo
Visualizing the actin cytoskeleton in living plant cells using a photo

... This article is available from: http://www.plantmethods.com/content/4/1/21 ...
What is a protein?
What is a protein?

... 2. Separate cell components 3. Distinguish the protein of interest 4. Separate the protein of interest 5. Retrieve the protein of interest ...
Seven Zinc Finger transcription factors are novel regulators of the
Seven Zinc Finger transcription factors are novel regulators of the

... KKRFRTKFTTDQKERMMDFAEKLGWRMNKQDEEELKRFCGEIGVKRQVFKVWMHNNKN RKRFRTKFSQYQKEKMFEFSERVGWRMPKADDVVVKEFCREIGVDKSVFKVWMHNNKI ...
Photoactivatable GFP tagging cassettes for protein
Photoactivatable GFP tagging cassettes for protein

... none has been exploited for studies in budding yeast. We describe here the construction of yeast-tagging vectors containing photoactivatable green fluorescent protein (PA–GFP) for analysis of protein behaviour. We tagged two yeast proteins, Erg6p and Num1p, with PA–GFP and demonstrated specific phot ...
Human CHMP6, a myristoylated ESCRT-III protein, interacts directly
Human CHMP6, a myristoylated ESCRT-III protein, interacts directly

... playing still unclarified roles in invagination of endosomal membranes to form MVBs [16]. They are coiled-coil proteins of approx. 200 amino acid residues and exhibit an uneven distribution of charged residues, resulting in creation of basic and acidic regions in the N-terminal half and C-terminal h ...
Quality Control
Quality Control

... transfected with either Q25-GFP or Q103-GFP, as indicated, and sorted into populations containing the lowest or highest 10% of GFP fluorescence. Each lane contains lysates from ~40,000 cells. (B) Two-parameter FACS profiles of HEK cells transfected with GFP, Q25GFP, or Q103-GFP. GFP fluorescence is ...
supplement
supplement

... Comparison of Drosophila embryos stained with anti-ETO Ab-1 and anti-Nvy (Fig. 2 in main text). Overnight collections of nvyPDFKG1/CyO, Kr>GFP or Oregon-R embryos were fixed and prepared for confocal microscopy as previously described (1). Rabbit anti-ETO was used at the same concentration as previo ...
PGLO Transformation LAB AP LAB 7
PGLO Transformation LAB AP LAB 7

... Purple- label • 1- colored eraser (to ID your tubes in water bath) ...
Cloning A population of cells produced from a single cell contains
Cloning A population of cells produced from a single cell contains

... With pGLO transformation, students transform bacteria with a gene that codes for a green fluorescent protein (GFP). The natural source for the GFP gene is the bioluminescent jellyfish, Aequorea victoria. The gene encodes for the GFP which allows the jellyfish to glow in the dark. The protein absorbs ...
In vivo interactions of higher plant Golgi matrix proteins by
In vivo interactions of higher plant Golgi matrix proteins by

... epidermal cells and was in the range of 2.4 – 2.6 ns (Fig. 2a). As a control a double expression was carried out with GFP and mRFP fused to the same Golgi protein, the ST marker (Boevink et al. 1998) [2]. This resulted in double labelling of all Golgi in transformed cells and lifetime images of GFP ...
Document
Document

... Surrounded by double membrane and contain own DNA, but codes for very few proteins! (a few dozen) Instead, most genes from prokaryotic ancestor have been transferred to the nucleus, so proteins must be imported ...
A Novel, Multifactorial Approach for hiPSC Differentiation
A Novel, Multifactorial Approach for hiPSC Differentiation

... labeled TRA-1-60 antibody. In a standard well plate experiment, cells stained with the same method demonstrated the same TRA1-60 expression on IFC (scale bar = 490 µm) (A). To determine if indeed hiPSCs cultured on IFC and on standard well plates were indistinguishable at the population level, we ha ...
pptx - FenyoLab.org
pptx - FenyoLab.org

... High mass accuracy MS/MS is recommended because the spectrum will be a mixture of fragment ions from two peptides. Because the cross-linked peptides are often large, CAD is not ideal, but instead ETD is recommended. ...
E.coli Tic Tacs
E.coli Tic Tacs

... 2. Experiment with different concentration of L-Arabinose to examine the promoter activity. 3. If time permits, we will look for a promoter that allows this arrangement: Regular Promoter ...
Where are Our Computational Bottlenecks?
Where are Our Computational Bottlenecks?

... • Mechanical loading of bone and Finite Element Analysis models—associate with select gene expression • Osteocytes biology-mechanosenors in bone • Imaging osteocytes at work in health and disease. • Pathways and gene networks unique to osteocytes and the mechanical loading. • Connect “List of genes” ...
Comparing Sequences of Fluorescent Proteins Using
Comparing Sequences of Fluorescent Proteins Using

... colors that can be generated by mutating the gfp gene. Other sources of fluorescent proteins have been sought – and found – resulting in even greater diversity of fluorescent proteins. Research Questions: The cloning and protein purification experiments you have been conducting in the laboratory inv ...
Supplementary Figures 1-14.
Supplementary Figures 1-14.

... occurring form of chemiluminescence in many organisms, such as the jellyfish, sea pansy, and firefly. A small-molecule substrate luciferin is oxidized in the presence of the enzyme luciferase to produce oxyluciferin and a photon (Wilson and Hastings, 1998). Bioluminescence imaging has been widely us ...
How to Study and Exploit microRNAs for Gene Therapy Bernhard Gentner, M.D.
How to Study and Exploit microRNAs for Gene Therapy Bernhard Gentner, M.D.

... microRNA: an abundant class of non-coding RNA • >700 miRNA species known in human, most are highly conserved in mammals • negatively regulate HALF of ALL mRNA transcripts by • directing mRNA destruction • inhibiting translation • extent of regulation of single targets may seem minor (in general 2-3 ...
immunoassy .Dr moaednia
immunoassy .Dr moaednia

... excitation due to irreversible decomposition of the fluorochromes • The fading can be reduced if mounting media contain antioxidants ...
An indelible lineage marker for Xenopus using a
An indelible lineage marker for Xenopus using a

... Although not often carried out, the transplantation of single cells to ectopic sites in an embryo can give valuable information on the importance of local cell interactions (Heasman et al., 1984; Kato and Gurdon, 1992). In contrast to lineage studies, which determine the fate of cells surrounded by ...
iclicker - University of Colorado-MCDB
iclicker - University of Colorado-MCDB

... How pluripotency of a stem cell is maintained by a general repressor ...
Cellular Imaging and Analysis FAQs
Cellular Imaging and Analysis FAQs

... DNA repair protein. It has been modified to make it smaller (20 kD), react faster with its benzyl guanine substrates and to remove its affinity for DNA. In mammalian cells, SNAP-tag localizes to the cytoplasm and the nucleus. 2. How does it work? The SNAP-tag is a protein tag that forms a highly sta ...
< 1 ... 18 19 20 21 22 23 24 25 26 ... 30 >

Green fluorescent protein



The green fluorescent protein (GFP) is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to light in the blue to ultraviolet range. Although many other marine organisms have similar green fluorescent proteins, GFP traditionally refers to the protein first isolated from the jellyfish Aequorea victoria. The GFP from A. victoria has a major excitation peak at a wavelength of 395 nm and a minor one at 475 nm. Its emission peak is at 509 nm, which is in the lower green portion of the visible spectrum. The fluorescence quantum yield (QY) of GFP is 0.79. The GFP from the sea pansy (Renilla reniformis) has a single major excitation peak at 498 nm.In cell and molecular biology, the GFP gene is frequently used as a reporter of expression. In modified forms it has been used to make biosensors, and many animals have been created that express GFP as a proof-of-concept that a gene can be expressed throughout a given organism. The GFP gene can be introduced into organisms and maintained in their genome through breeding, injection with a viral vector, or cell transformation. To date, the GFP gene has been introduced and expressed in many Bacteria, Yeast and other Fungi, fish (such as zebrafish), plant, fly, and mammalian cells, including human. Martin Chalfie, Osamu Shimomura, and Roger Y. Tsien were awarded the 2008 Nobel Prize in Chemistry on 10 October 2008 for their discovery and development of the green fluorescent protein.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report