Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
1. Neighbor-joining The following file contains sequences from precomputed psi-blast search for the human estrogen receptor alpha (ESR1_HUMAN) against nrdb30 database from the PairsDB database. Hormone_receptors.fasta Align the sequences in hormone_receptros.fasta using muscle, save the file in fasta format. Convert the file from fasta to meg format using Mega. File > Convert to MEGA format ... In order for Mega to parse your alignment correctly. You will need to remove comma characters (,) from the sequence names using Mega text editor. Use Mega text editor to replace, with a blank space. Make sure all comma characters are replaced by selecting: Replace > Scope > Global Phylogenetic analysis Compute a Neighbour-Joining tree for your alignment. Use the JTT substitution matrix in distance computation and gamma correction with gamma parameter value 2.4 (Molecular Evolution and Phylogenetics, Nei & Kumar 2000). Phylogeny > Construct phylogeny > Neighbour-Joining Model > Amino acid > JTT matrix Bootstrap test Compute bootstrap test using 100 replicates. Typically it is recommended to perform at least 500 replicates but in order to make computation faster will use only 100 replicates here. Identify and name the following subfamilies in the tree. Use: Right mouse button > selected subtree Estrogen receptor αs Estrogen receptor βs Androgen receptors Progesterone receptors Estrogen like pseudogenes (ERRs) Change the colour of the subfamily branches from: Subtree > Draw options Compress the retinoid receptor family branch and define it as the outgroup. Identify and low confidence nodes that have bootsrap values below 70 % Q 1. Copy paste the tree image below. 2. Phylogenomic functional annotation Using the hormone receptor subfamily sequences from the previous exercise as reference, predict the function of these putative hormone receptor sequences (seq1, seq2) predicted from the hedgehog genome. Add sequences seq1 and seq2 to the sequence file and repeat the analysis procedure in exercise 1. Find out which subfamily do these cluster in. Remove retinoid family sequences from the analysis. Hints: Due to incomplete genome assembly parts of the protein sequence are uncertain and marked with X. When opening your meg file specify the symbol for missing data to be capital X. >Seq1 PSSESRRQAGRERLASSGDKGSLSMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKR SIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQR DDGEARSESGPSGDMRATTLWPSPLVIKHTKKNSPALSLTAEQMVSALLEAEPPFIYSEY DPTRPFSEASMMGLLTNLADRELVHMINWAKRVPXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXNLLLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLIL SHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPANRGAAATMEEMSQGPLAT NGQASHSLQTYYITGEAENFPTI >Seq2 EALKRKVSRSSCASPVTSPSTKKDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQXXX XXXXXXXXXXXIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRILRRQRNSDEQLHC LSKAKKNGGHVTRVKELLLNSLSPEQLVLTLLEAEPPNVLVSRPNTPFTEASMMMSLTKL ADKELVHMIGWAKKIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFAPDLV LDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLAAATQEGE SSQKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHVRHASNKGMEHLLSMKC KNVVPVYDLLLEMLNAHTLRGYKSSVTRSECSPAEDSKSKEGSHNPQSQ Q 2.1 Copy paste the tree image below. Q 2.2 Identify the subfamily and function for seq1 and seq2