* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download CMBI
Molecular ecology wikipedia , lookup
Clinical neurochemistry wikipedia , lookup
G protein–coupled receptor wikipedia , lookup
Gene regulatory network wikipedia , lookup
Magnesium transporter wikipedia , lookup
Silencer (genetics) wikipedia , lookup
Metalloprotein wikipedia , lookup
Expression vector wikipedia , lookup
Gene expression wikipedia , lookup
Endogenous retrovirus wikipedia , lookup
Biochemical cascade wikipedia , lookup
Metabolic network modelling wikipedia , lookup
Ancestral sequence reconstruction wikipedia , lookup
Drug design wikipedia , lookup
Western blot wikipedia , lookup
Point mutation wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Structural alignment wikipedia , lookup
Proteolysis wikipedia , lookup
Interactome wikipedia , lookup
The CMBI: Bioinformatics Content Bioinformatics Bioinformatics@CMBI Bioinformatics tools & databases Celia van Gelder CMBI UMC Radboud February 2009 c.vangelder@cmbi.ru.nl What is bioinformatics? • Bioinformatics is the use of computers in solving information problems in the life sciences • You are "doing bioinformatics" when you use computers to store, retrieve, analyze or predict the sequence, function and/or structure of biomolecules. Bioinformatics 2/37 ©CMBI 2009 Human genome, great expectations Data ≠ Knowledge, insight !!! Bioinformatics 3/37 ©CMBI 2009 Why do we need Bioinformatics? Flood of biological data: – – – – – DNA-sequences (genomes) protein sequences and structures gene expression profiles (transcriptomics) cellular protein profiles (proteomics) cellular metabolite profiles (metabolomics) We want to : – – – – – Bioinformatics collect and store the data integrate, analyze, compare and mine the data predict genes, protein function and protein structure predict physiology (models, mechanisms, pathways) understand how a whole cell works 4/37 ©CMBI 2009 A large fraction of the human genes has an unknown function (Science, 2001) Bioinformatics 5/37 ©CMBI 2009 What is protein function? Genomic context Homology Bioinformatics 6/37 ©CMBI 2009 How can we predict function of proteins? The importance of sequence similarity and sequence alignment Similar sequences have: – A similar evolutionary origin – A similar function – A similar 3D structure “new, unknown protein” Compare with database of proteins BLAST “similar sequence with known function. E.g. proteine kinase” Extrapolate the function Bioinformatics 7/37 ©CMBI 2009 CMBI - Centre for Molecular and Biomolecular Informatics • •Dutch national centre for computational molecular sciences research •Research groups –Comparative Genomics (Huynen) –Bacterial Genomics (Siezen) –Computational Drug Design (De Vlieg) –Bioinformatics of Macromolecular Structures (Vriend) •Training & Education –MSc, PhD and PostDoc programmes –International workshops –Hotel Bioinformatica –High school courses •Computational facilities, databases, and software packages via (inter-)national service platforms (NBIC, EBI, etc) •NBIC: National BioInformatics Centre. Bioinformatics @CMBI 8/37 ©CMBI 2009 Computational Drug Discovery (CDD) Group • Head: Prof. Jacob de Vlieg • Key goal Develop molecular modeling and computer-based simulation techniques for structure-based drug design, translational medicine and protein family based approaches to design and identify drug-like compounds • Key – – – Research Fields Structural bioinformatics for drug design Bioinformatics for genomics (microarray analysis, text mining, etc) Translational medicine informatics Academic Research New scientific approaches Training & education CDD Applications Exciting real life problems ‘wet’ validation Bridging academic research and applied genomics Bioinformatics @CMBI 9/37 ©CMBI 2009 Examples of CDD Projects •Exploiting Structural Genomics Information To Incorporate Protein Flexibility In Drug Design •Protein knowledge building through comparative genomics and data integration •In silico studies on p63 as a new drug-target protein Bioinformatics @CMBI 10/37 ©CMBI 2009 International Computational Drug Discovery Course •Course covers the entire research pipeline from genomics and proteomics in target discovery to Structure Based Drug Design and QSAR in drug optimization. •Lectures and practicals •2 week course •June/July 2009 •www.cmbi.ru.nl/ICDD2008 Bioinformatics @CMBI 11/37 ©CMBI 2009 Bacterial Genomics Group • Head: Prof Roland Siezen • Research interest: Biological questions in the interest of Dutch Food Industry • How – – – • Micro-organisms studied: Gram-positive food bacteria: – lactic acid bacteria (Lactococcus, Lactobacillus) – spoilage bacteria (Listeria, Clostridium, Bacillus cereus) can we improve: fermentation safety health lactococcus listeria Bioinformatics @CMBI 12/37 ©CMBI 2009 Bacterial Genomics: from sequence to predicted function Key research fields: – Genome sequencing and interpretation – Network reconstruction and analysis – Systems biology, dynamic modelling Raw sequence data: 2 to 5 million nucleotides A virtual cell: overview of predicted pathways AAACACTTAGACAATCAATATAAAGATGAA GTGAACGCTCTTAAAGAGAAGTTGGAAAAC TTGCAGGAACAAATCAAAGATCAAAAAAGG ATAGAAGAACAAGAAAAACCACAAACACTT AGACAATCAATATAAAGATGAAGTGAACGC TCTTAAAGAGAAGTTGGAAAACTTGCAGGA ACAAATCAAAGATCAAAAAAGGATAGAAGA ACAAGAAAAACCACAAACACTTAGACAATC AATATAAAGATGAAGTGAACGCTCTTAAAG AGAAGTTGGAAAACTTGCAGGAACAAATCA AAGATCAAAAAAGGATAGAAGAACAAGAAA AACCACAAACACTTAGACAATCAATATAAA GATGAAGTGAACGCTCTTAAAGAGAAGTTG GAAAACTTGCAGGAACAAATCAAAGATCAA AAAAGGATAGAAGAACAAGAAAAACCACAA ACACTTAGACAATCAATATAAAGATGAAGT GAACGCTCTTAAAGAGAAGTTGGAAAACTT GCAGGAA Bioinformatics @CMBI 13/37 ©CMBI 2009 Bacterial Genomics: Example Differential NF-κB pathways induction by Lactobacillus plantarum in the duodenum of healthy humans correlating with immune tolerance Peter van Baarlen et al., PNAS, Febr 3, 2009 Bioinformatics @CMBI 14/37 ©CMBI 2009 Comparative Genomics Group • Head: Prof. Martijn Huynen • Research Focus: – How do the proteins encoded in genomes interact with each other to produce cells and phenotypes ? – To predict such functional interactions between proteins as there exist e.g. in metabolic pathways, signalling pathways or protein complexes A genome is more than the sum of its genes -> Use “genomic context” for function prediction Types of genomic context: Gene fusion/fission Chromosomal location Gene order/neighbourhood Co-evolution Co-expression Bioinformatics @CMBI 15/37 ©CMBI 2009 Turning data into knowledge Research topics: • Develop computational genomics techniques that exploit the information in sequenced genomes and functional genomics data • Make testable predictions about pathways and the functions of proteins therein. • Evolution of the eukaryotic cell and in the origin and evolution of organelles like the mitochondria and the peroxisomes Education: • Comparative Genomics Course, 3 EC, April 2009 Comparative genomics Prediction of protein function, pathways Bioinformatics @CMBI 16/37 ©CMBI 2009 Frataxin Example • Frataxin is a well-known disease gene (Friedreich's ataxia) whose function has remained elusive despite more than six years of intensive experimental research. • Using computational genomics we have shown that frataxin has co-evolved with hscA and hscB and is likely involved in iron-sulfur cluster assembly in conjunction with the co-chaperone HscB/JAC1. Prediction Bioinformatics @CMBI Confirmation 17/37 ©CMBI 2009 Bioinformatics of macromolecular structures •Head: Prof. Gert Vriend •Research Focus: Understanding proteins (and their environment) •Proteins are the core of life, they do all the work, and they give you feelings, contact with the outside world, etc. •Proteins, therefore, are the most important molecules on earth. •We want to understand life; why are we what we are, why do we do what we do, how come you can think what you think? Bioinformatics @CMBI 18/37 ©CMBI 2009 Bioinformatics of macromolecular structures Research topics Vriend group •Homology modeling technology and applications •Application of bioinformatics in medical research (Hanka Venselaar) •Structure validation and structure determination improvement •Molecular class specific information systems (e.g. GPCRDB & NucleaRDB) •Data mining •WHAT IF molecular modelling and visualization software Bioinformatics @CMBI 19/37 ©CMBI 2009 Homology Modeling Hearing loss DFNB63: MGTPWRKRKGIAGPGLPDLSCALVLQPRAQVGTMSPAI ALAFLPLVVTLLVRYRHYFRLLVRTVLLRSLRDCLSGLRI EERAFSYVLTHALPGDPGHILTTLDHWSSRCEYLSHMG PVKGQILMRLVEEKAPACVLELGTYCGYSTLLIARALPP GGRLLTVERDPRTAAVAEKLIRLAGFDEHMVELIVGSSE DVIPCLRTQYQLSRADLVLLAHRPRCYLRDLQLLEAHAL LPAGATVLADHVLFPGAPRFLQYAKSCGRYRCRLHHTG LPDFPAIKDGIAQLTYAGPG Homology modeling: Prediction of 3D structure based upon a highly similar structure Unknown structure Bioinformatics @CMBI Homology Modeling Prediction of 3D structure based upon a highly similar structure NSDSECPLSHDG NSDSECPLSHDG || || | || NSYPGCPSSYDG Unknown structure Alignment of model and template Known structure sequence Known structure Bioinformatics @CMBI Model! Add sidechains, Molecular Back bone copied Dynamics simulation on model Copy backbone and conserved residues 21/37 ©CMBI 2009 Homology Modeling Structure! DFNB63: MGTPWRKRKGIAGPGLPDLSCALVLQPRAQVGTMSPAI ALAFLPLVVTLLVRYRHYFRLLVRTVLLRSLRDCLSGLRI EERAFSYVLTHALPGDPGHILTTLDHWSSRCEYLSHMG PVKGQILMRLVEEKAPACVLELGTYCGYSTLLIARALPP GGRLLTVERDPRTAAVAEKLIRLAGFDEHMVELIVGSSE DVIPCLRTQYQLSRADLVLLAHRPRCYLRDLQLLEAHAL LPAGATVLADHVLFPGAPRFLQYAKSCGRYRCRLHHTG LPDFPAIKDGIAQLTYAGPG Hearing loss Bioinformatics @CMBI Homology Modeling Mutations: •Arginine 81 -> Glutamic acid •Glutamic acid 110 -> Lysine Saltbridge between Arginine and Glutamic acid is lost in both cases Bioinformatics @CMBI 23/37 ©CMBI 2009 Homology Modeling Mutation: •Tryptophan 105 -> Arginine Hydrophobic contacts from the Tryptophan are lost, introduction of an hydrophilic and charged residue Bioinformatics @CMBI 24/37 ©CMBI 2009 Homology Modeling The three mutated residues are all important for the correct positioning of Tyrosine 111 Tyrosine 111 is important for substrate binding Ahmed et al., Mutations of LRTOMT, a fusion gene with alternative reading frames, cause nonsyndromic deafness in humans. Nat Genet. 2008 Nov;40(11):1335-40. Interested? Contact Hanka Venselaar (h.venselaar@cmbi.ru.nl) Bioinformatics @CMBI 25/37 ©CMBI 2009 Hotel Bioinformatica Hotel functions • Temporary housing, teaching and supervision of experimentalists for data analysis at the CMBI • Centralization of UMC-wide bioinformaticians • Shared (weekly) seminars of CMBI with ‘inhouse bioinformaticians’ • Collaboration/advice in acquiring grants with a Bioinformatics aspect Interested? Contact Martijn Huynen (m.huynen@cmbi.ru.nl) Bioinformatics @CMBI 26/37 ©CMBI 2009 Bioinformatics data types mRNA expression profiles MS data Large amount of data Growing very very fast Heterogeneous data types Bioinformatics Tools & Databases 27/37 ©CMBI 2009 Biological Databases • • Information is the core of bioinformatics Literally thousands of databases exist that are relevant for biology, medicine, and/or chemistry Content Database protein sequences SwissProt UniProt trEMBL nucleotide sequences EMBL GenBank DDBJ structures (protein, DNA, RNA) Protein Data Bank (PDB) Genomes Ensembl UCSC Mutations OMIM Patterns, Motifs PROSITE Protein Domains InterPro SMART Pathways Bioinformatics Tools & Databases KEGG 28/37 ©CMBI 2009 Important records in SwissProt/UniProt (1) Bioinformatics Tools & Databases 29/37 ©CMBI 2009 Important records in SwissProt/UniProt (2) Cross references Features Direct hyperlinks to: • EMBL • PDB • OMIM, • InterPro • etc. etc. • • • • • • • Bioinformatics Tools & Databases post-translational modifications signal peptides binding sites, enzyme active sites domains, disulfide bridges etc. etc. 30/37 ©CMBI 2009 Protein Databank & Structure Visualization • PDB structures have a unique identifier, the PDB Code: 4 digits (often 1 digit & 3 letters, e.g. 1CRN). • Download PDB structures, give correct file extension: 1CRN.pdb • Structures from PDB can directly be visualized with: 1. 2. 3. 4. Bioinformatics Yasara (www.yasara.org) SwissPDBViewer (http://spdbv.vital-it.ch/) Protein Explorer (http://www.umass.edu/microbio/rasmol/) Cn3D (http://www.ncbi.nlm.nih.gov/Structure/CN3D/cn3d.shtml) Tools & Databases 31/37 ©CMBI 2009 OMIM Database OMIM - Online Mendelian Inheritance in Man • • • a large, searchable, current database of human genes, genetic traits, and hereditary disorders contains information on all known mendelian disorders and over 12,000 genes focuses on the relationship between phenotype and genotype Bioinformatics Tools & Databases 32/37 ©CMBI 2009 Browsing genomes NCBI UCSC http://genome.ucsc.edu/ Only eukaryotic genomes Bioinformatics Tools & Databases Ensembl http://www.ensembl.org/ 33/37 ©CMBI 2009 Sequence Retrieval with MRS (1) Google = Thé best generic search and retrieval system = Maarten’s Retrieval System (http://mrs.cmbi.ru.nl ) MRS MRS is the Google of the biological database world Search engine (like Google) Input/Query = word(s) Output = entry/entries from database Searching is very intuitive: – Select database(s) of choice – Formulate your query – Hit “Search” – The result is a “query set” or “hitlist” – Analyze the results Bioinformatics Tools & Databases 34/37 ©CMBI 2009 Sequence Retrieval with MRS (2) Select database Formulate query. But think about your query first!! MRS hitlist Bioinformatics Tools & Databases 35/37 ©CMBI 2009 BLAST and CLUSTAL with MRS Blast brings you to the MRS-page from which you can do Blast searches. Blast results brings you to the page where MRS stores your Blast results of the current session. Clustal brings you to the MRS page from which you can do Clustal sequence alignments. Bioinformatics Tools & Databases 36/37 ©CMBI 2009 Your Exercise Today FAMILIAL VISCERAL AMYLOIDOSIS You will study Lysozyme: •Protein •Gene •Mutations causing familial visceral amyloidosis •3D structure HAVE FUN!! Bioinformatics Tools & Databases 37/37 ©CMBI 2009