Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Vector information sheet. Vector Name pFB-Sec-NH Source Sequence accession/link Grazyna Kochan (SGC) Description Baculovirus transfer vector with a signal peptide (from baculovirus gp64), a His6 tag and a TEV protease cleavage site fused to the N-terminal of the cloned protein. Used for secreted or integral membrane proteins. Includes sites for LIC cloning, and a “stuffer” fragment that includes the SacB gene, allowing negative selection of transformed bacteria on 5% sucrose Antibiotic resistance Promoter Cloning Initiation codon N-terminal fusion – seq. N-terminal fusion – MW Termination codons Protease cleavage Additional features Preferred host 5’ sequencing primer 3’ sequencing primer Ampicillin, 100 g/ml Polyhedrin LIC. (vector treated with BseRI, then with T4 DNA polymerase in presence of dGTP) Supplied in PCR primer MVSAIVLYVLLAAAAHSAFAAAMGHHHHHHSSGVDLGTENLYFQ*SM (* - TEV cleavage site) 5012 Da including Met (4682.9 Da removed by TEV cleavage) supplied in PCR primer TEV Tn7 sequences for in vivo recombination into bacmid DNA in DH10Bac (using Invitrogen’s Bac-to-bac system). Initial transformation into any cloning strain, then transform purified plasmid into DH10Bac to generate recombinant bacmid DNA FBAC1: TATTCATACCGTCCCACCA FBAC2: GGGAGGTTTTTTAAAGCAAGTAAA Tn7L pFBac-2 primer HindIII (6848) Pst I (6839) F1 origin BamHI (6785) Bse RI (6769) 3'LIC AmpR SacB pFB-Se c-NH Bse RI (4756) 7386 bp pUC origin 5'LIC His/TEV 6xHIS gp64 sig seq pFBac-1 primer PH promoter Tn7R GentR PH promoter ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ pFBac-1 primer ~~~~~~~~~~~~~~~~~~~~~ 4561 4621 4681 4741 gp64 sig seq ~~~~ M V · CCTATAAATA TTCCGGATTA TTCATACCGT CCCACCATCG GGCGCGGATC TAAAACATGG GGATATTTAT AAGGCCTAAT AAGTATGGCA GGGTGGTAGC CCGCGCCTAG ATTTTGTACC gp64 sig seq ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ · S A I V L Y V L L A A A A H S A F A A A · TAAGCGCTAT TGTTTTATAT GTGCTTTTGG CGGCGGCGGC GCATTCTGCC TTTGCGGCCG ATTCGCGATA ACAAAATATA CACGAAAACC GCCGCCGCCG CGTAAGACGG AAACGCCGGC His/TEV ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 6xHIS 5'LIC ~~~~~~~~~~~~~~~~~~~~ ~ · M G H H H H H H S S G V D L G T E N L Y · CCATGGGCCA CCATCATCAT CATCATTCTT CTGGTGTAGA TCTGGGTACC GAGAACCTGT GGTACCCGGT GGTAGTAGTA GTAGTAAGAA GACCACATCT AGACCCATGG CTCTTGGACA His/TEV ~~~~~~~~ 5'LIC ~~~~~~~~~~~~~~ BseRI ~~~~~~ · F Q ACTTCCAATC CATAAGCTAG CTTCTCCTCC TGAAGGTTAG GTATTCGATC GAAGAGGAGG SacB linker-- -- 3'LIC ~~~~~~~~~~~~~ 6721 6781 BseRI ~~~~~~ CCTATTGGCA TTGACGTCAG GTGGCACTTT TCGAGGAGTT TACTAGTAAG TAAAGGTGGA GGATAACCGT AACTGCAGTC CACCGTGAAA AGCTCCTCAA ATGATCATTC ATTTCCACCT 3'LIC ~~ BamHI PstI ~~~~~~ ~~~~~~ TACGGATCCG AATTCGAGAA TCGAATTCCC GCGGCCGCTT TCGAATCTAG AGCCTGCAGT ATGCCTAGGC TTAAGCTCTT AGCTTAAGGG CGCCGGCGAA AGCTTAGATC TCGGACGTCA Primers for LIC cloning: Upstream: add TACTTCCAATCCATG to the 5’ end (ATG in-frame with the desired coding sequence). Downstream: add TATCCACCTTTACTG to 5’ end of downstream primer; add termination codon, if necessary.