* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download The role of protein–protein interactions in the intracellular traffic of
Histone acetylation and deacetylation wikipedia , lookup
Protein (nutrient) wikipedia , lookup
Cell membrane wikipedia , lookup
SNARE (protein) wikipedia , lookup
Magnesium transporter wikipedia , lookup
Protein phosphorylation wikipedia , lookup
Protein domain wikipedia , lookup
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Mechanosensitive channels wikipedia , lookup
G protein–coupled receptor wikipedia , lookup
Protein moonlighting wikipedia , lookup
Endomembrane system wikipedia , lookup
Intrinsically disordered proteins wikipedia , lookup
Western blot wikipedia , lookup
Signal transduction wikipedia , lookup
List of types of proteins wikipedia , lookup
Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 DOI 10.1007/s00424-014-1672-2 INVITED REVIEW The role of protein–protein interactions in the intracellular traffic of the potassium channels TASK-1 and TASK-3 Markus Kilisch & Olga Lytovchenko & Blanche Schwappach & Vijay Renigunta & Jürgen Daut Received: 20 November 2014 / Revised: 10 December 2014 / Accepted: 11 December 2014 / Published online: 7 January 2015 # Springer-Verlag Berlin Heidelberg 2015 Abstract The intracellular transport of membrane proteins is controlled by trafficking signals: Short peptide motifs that mediate the contact with COPI, COPII or various clathrinassociated coat proteins. In addition, many membrane proteins interact with accessory proteins that are involved in the sorting of these proteins to different intracellular compartments. In the K2P channels, TASK-1 and TASK-3, the influence of protein– protein interactions on sorting decisions has been studied in some detail. Both TASK paralogues interact with the adaptor protein 14-3-3; TASK-1 interacts, in addition, with the adaptor protein p11 (S100A10) and the endosomal SNARE protein syntaxin-8. The role of these interacting proteins in controlling the intracellular traffic of the channels and the underlying molecular mechanisms are summarised in this review. In the case of 14-3-3, the interacting protein masks a retention signal in the C-terminus of the channel; in the case of p11, the interacting protein carries a retention signal that localises the channel to the endoplasmic reticulum; and in the case of syntaxin-8, the interacting protein carries an endocytosis signal that complements an endocytosis signal of the channel. These examples illustrate some of the mechanisms by which interacting proteins may determine the itinerary of a membrane protein within a cell and suggest that the intracellular Markus Kilisch and Olga Lytovchenko contributed equally. This article is published as part of the special issue on K2P-channels. V. Renigunta (*) : J. Daut (*) Institute of Physiology and Pathophysiology, Marburg University, 35037 Marburg, Germany e-mail: vijay@staff.uni-marburg.de e-mail: jdaut@staff.uni-marburg.de M. Kilisch : O. Lytovchenko : B. Schwappach Institute of Molecular Biology, Göttingen University, 37073 Göttingen, Germany traffic of membrane proteins may be adapted to the specific functions of that protein by multiple protein–protein interactions. Keywords K2P-channels . Retention signal . Intracellular traffic . Endocytosis Introduction In trying to understand the function of a protein, it is necessary to study its interaction with other proteins. Many large proteins are highly dynamic and intrinsically unstable macromolecules that have surfaces capable of interacting with other proteins. In principle, interaction with other proteins can have the following effects on the function of a protein: (1) The folding and the stability of the protein can be enhanced by protein–protein interactions (PPI); the cytoplasm and the lumen of the endoplasmic reticulum (ER), for example, contain multiple molecular chaperones that enable or accelerate folding to the ‘native’ state of the protein [36, 37], but are not present in their final structure. (2) The assembly of multimeric proteins can be assisted by PPI [23, 24]. (3) The function of the protein may require the permanent interaction with other proteins; many proteins form homomeric or heteromeric complexes with obligatory accessory subunits. (4) The function of the protein may be temporarily suspended by interaction with another protein, for example, by association with inhibitory subunits. (5) The subcellular localisation and the itinerary of intracellular traffic of the protein may be altered by interaction with other proteins [40]. The proteins that influence intracellular traffic share some properties with chaperones; for example, they interact only transiently and are not present in the ‘final’ or ‘native’ form of the protein. To emphasise functional similarities between chaperones and adaptor proteins involved in trafficking, the concept of the ‘proteostasis trafficking 1106 network’ has been developed recently [37, 40]. (6) The binding of some interacting proteins depends on prior posttranslational modification of the target protein [99], e.g., phosphorylation [32, 91, 108]; this mechanism allows PPI to be regulated, e.g., via protein kinases. (7) Finally, it should be mentioned in this context that PPI have recently been recognised as a promising target for small-molecule drugs [1, 70, 81]. Ion channels are particularly suitable proteins for studying PPI because their biophysical properties (indicating their conformational state) and their copy number at the cell surface can be studied with high resolution using the patch-clamp technique [35]. Focusing on ion channels, numerous examples can be found where PPI are essential for their physiological function: First, many ion channels require additional regulatory subunits to acquire their typical biophysical properties such as gating and inactivation kinetics; this applies for sodium channels [15], potassium channels [84, 118], calcium channels [21] and chloride channels [102]. Second, some ion channels associate with inhibitory subunits that cause a reduction in the current [96, 106]. Third, many ion channels require the association with accessory proteins for their targeting to the correct subcellular compartments or for their efficient transport to the surface membrane. There are several principal mechanisms by which PPI can modulate the intracellular traffic: (1) An interacting protein can mask a trafficking signal of the channel, for example, an ER-localisation signal, and thus promote forward trafficking to the surface membrane [117]. (2) An interacting protein can carry an ER-localisation signal and thus impede forward trafficking of the channel to the surface membrane [93]. (3) An interacting protein can carry an endocytosis signal and thus promote internalisation of the channel [92]. (4) An interacting protein can stabilise a trafficking-competent conformation of the channel and in this way indirectly promote its surface expression [120]. In this review, we will focus on the intracellular traffic of a particular subfamily of two-pore-domain potassium channels (K2P-channels), namely the acid-sensitive K+ channels TASK-1 and TASK-3, in which the role of PPI in regulating intracellular has been studied in some detail, and we will give concrete examples of the four mechanisms mentioned above. The human genome contains 15 genes coding for two-pore domain potassium channels (K2P-channels). The structure of K2P-channels differs from that of the 63 other [33, 116] human potassium channels known: K2P-channel subunits have four transmembrane domains (M1–M4), two pore domains (P1 and P2) and two helical cap domains (C1 and C2) [13, 14, 66], as illustrated in Fig. 1a. Functional K2P-channels are usually homo-dimers with a twofold symmetry. The inner wall of the pore is formed by the two M2 and M4 domains. The selectivity filter of K2P-channels is formed by the two P1 and the two P2 domains; it is very similar to that of tetrameric potassium channels showing fourfold symmetry. The acid- Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 sensitive potassium channels TASK-1 [22], TASK-3 [45, 90] and TASK-5 [4, 43, 44] represent one of the five subfamilies of K2P-channels. The three TASK channels are highly homologous with >50 % identical amino acids. TASK-1 and TASK3 play an important role in the central and peripheral nervous system, in the heart, in the adrenal gland and in many other tissues [5, 25, 46]. The functional characteristics of the other member of the TASK subfamily, TASK-5, are still unknown. None of the groups investigating TASK-5 has been able to measure TASK-5 currents, either in heterologous expression systems or in native cells. TASK-5 is almost exclusively expressed in neurons of the auditory system [43]. Its subcellular localisation and its possible contribution to the electrical activity of the cells are still unclear. One of the characteristics that distinguishes TASK-1 and TASK-3 from other potassium channels is their pronounced inhibition by extracellular acidification. The channels are only moderately voltage dependent; their open probability increases with depolarisation [90]. Although the TASK-1 and TASK-3 currents measured in expression systems are very similar, the subcellular expression pattern and the singlechannel properties of TASK-1 and TASK-3 differ substantially. When expressed in mammalian cell lines, TASK-3 channels are predominantly localised to the surface membrane, whereas TASK-1 channels are largely retained in intracellular compartments [93]. Heterologous expression in Xenopus oocytes requires about 30 times higher amounts of complementary RNA (cRNA) for TASK-1 than for TASK-3. Injection of a small quantity of cRNA (50 pg) in Xenopus oocytes gives rise to large TASK-3 currents, but under the same conditions no TASK-1 currents can be recorded [93], as illustrated in Fig. 1b. Injecting the same amount of cRNA coding for a chimeric TASK-1/TASK-3 construct in which the C-terminus of TASK-3 was attached to the M4 domain of TASK-1 (T3/T1 construct) gives rise to nearly the same currents as injecting cRNA for TASK-3. Similar currents are also found with the reverse construct, in which the C-terminus of TASK-3 was attached to the M4 domain of TASK-1 (T1/T3 construct). These observations can be explained by the fact that (1) the single-channel conductance and the open probability of TASK-3 are higher than those of TASK-1 [22, 73, 90], and (2) the intracellular traffic of TASK-1 along the biosynthetic pathway is slower (and perhaps more tightly regulated) than that of TASK-3 [93]. In recent years, the concept has emerged that in many cell types the density of ion channels at the surface membrane, and thus their functional role, can be regulated posttranslationally: The bidirectional transport between endoplasmic reticulum (ER) and Golgi complex, i.e., ER export and retrieval, the export from and retrieval to the Golgi complex, the endocytosis and the recycling as well as the rate of degradation of the channels can be modulated by interaction with coat proteins, adaptor proteins and other interacting proteins [17, 48, 50, 51, Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 1107 Fig. 1 Functional topology of TASK channel subunits; two subunits assemble in an antiparallel fashion to form a functional channel. a The topology of TASK-1; the four transmembrane α-helices (M1-M4), the two pore helices (P1 and P2), the two cap helices (C1 and C2) and the cytosolic regions involved in regulating intracellular traffic are shown; blue line, selectivity filter; red spheres, permeating K+ ions. The 14-3-3 binding domains at the extreme C-terminus of TASK-, TASK-3 and TASK-5 are compared. b Comparison of the relative current amplitudes of TASK-1, TASK-3 (and chimeras thereof) expressed in Xenopus oocytes; T3/T1 represents a TASK-3 channel whose cytosolic C-terminus was replaced by the C-terminus of TASK-1; T1/T3 represents the TASK1 channel whose cytosolic C-terminus was replaced by the C-terminus of TASK-3. The same very low amount of cRNA (50 pg/oocyte) was injected into the oocytes for each construct. The current amplitude was determined as the acid-sensitive current that could be inhibited by decreasing the extracellular pH to 6.0. The current was recorded in the same batches of oocytes; the current measured with the T1/T3 chimera was taken as a reference point (from Renigunta et al. [93]). It should be noted that large TASK-1 currents can be recorded after injection of higher quantities of TASK-1 cRNA (0.75-3 ng/oocyte [92, 93, 120]) 61, 83, 109, 110]. In this review, we will summarise our current knowledge on the intracellular transport of K2P-channels of the TASK subfamily, and we will use these channels to illustrate the different mechanisms by which PPI can modulate intracellular traffic. The endocytosis of K2P-channels [75] and the intracellular transport of TWIK-1 and THIK-2 channels [8] are reviewed in two other articles of this special issue on K2P-channels. seven isoforms of 14-3-3 proteins. They have no enzymatic activity or cellular function of their own, but they can alter the function of numerous other proteins (their ‘clients’) by binding to one of the conserved 14-3-3 binding domains [28, 78, 79, 91, 101]. In most cases, the binding of 14-3-3 proteins is dependent on the phosphorylation of the serine present in the 14-3-3 binding motifs of their clients. Thus, 14-3-3 proteins may be regarded as universal switch proteins whose functional role depends entirely on the properties of their clients. TASK channels were the first ion channels identified as clients of 14-3-3 proteins [88, 89]. Yeast-two-hybrid screens using the entire C-terminus of rat TASK-1, TASK-3 and TASK-5 as bait identified 14-3-3 proteins as interacting partners of TASK-1, TASK-3 and TASK-5 [88, 89]. Using three different complementary DNA (cDNA) libraries from rat brain, four A tri-basic retention signal in the C-terminus of TASK-1 and TASK-3: the role of 14-3-3 proteins The 14-3-3 proteins are small acidic proteins which are highly expressed in all eukaryotic cells. The human genome contains 1108 a Curren nt (μA) 3 2 TASK-3 1 ∆C1 0 -120 -100 -80 -60 -40 -20 0 20 Membrane potential (mV) b Current ((μA) 6 4 TASK-1 2 ∆C1 0 -120 -100 -80 -60 -40 -20 0 20 Membrane potential (mV) c 1.2 Normalised current amplitude N different isoforms of 14-3-3 (σ, β, θ and ζ) were found to interact with TASK-1 [88]. Screening of a human heart cDNA library with the last 16 amino acids of human TASK-1 independently yielded 14-3-3β as an interacting protein [76]. Progressive truncation of the C-terminus from the proximal side showed that the last 40 amino acids of TASK-1 contributed to the binding of 14-3-3 and that the last five amino acids of TASK-1 (RRSSV-COOH, Fig. 1) were essential for interaction with 14-3-3 proteins [88]. The consensus motif for binding of 14-3-3 was found to be RRxSx-COOH [88], a variant of the socalled mode-3 binding motif for 14-3-3 proteins [100, 101]. Mutants of TASK-1 or TASK-3 that are incapable of interacting with 14-3-3 proteins produce only very small currents or no measurable current at all [76, 88]. For example, deletion of the ultimate amino acid at the C-terminus (ΔC1 mutation) abolished interaction between TASK channels and 14-3-3 proteins in the yeast-two hybrid assay, caused the accumulation of TASK channels in the Golgi complex [120] and reduced TASK-1 and TASK-3 currents in heterologous expression systems to very low levels [76, 88, 120], as illustrated in Fig. 2. The effects of the C-terminal deletions on the TASK currents measured in heterologous expression systems are entirely attributable to changes in surface expression of TASK-1 and TASK-3. The biophysical properties of the channels are unaffected by the C-terminal deletions [88]. The striking effects of the ΔC1 mutations on the TASK current amplitude could be reproduced using a reporter construct based on the membrane protein CD8, a co-receptor expressed in cytotoxic T-cells. The cytosolic C-terminus of TASK-1 or TASK-3, or the corresponding ΔC1 or ΔC5 mutants, was attached to the intracellular C-terminus of CD8, and the changes in the subcellular localisation of this fusion protein were visualised in COS-7 cells using fluorescence imaging. Figure 3 shows that the wild-type CD8 construct is localised to the cell surface (as indicated by the homogeneous staining of the entire surface of the COS-7 cells). The ΔC5 mutant also shows cell surface staining (albeit less than the CD8 fusion protein containing the wild-type C-terminus), with some of the protein being retained in the Golgi complex. In contrast, the ΔC1 mutant shows striking intracellular retention. The role of the last six amino acids of C-terminus of TASK1 and TASK-3 in the intracellular traffic of the channels was studied by systematic mutagenesis of another set of CD8TASK fusion proteins in which only the last 44 amino acids of TASK-1 or TASK-3 were attached to the C-terminus of CD8. The surface expression of these reporter constructs was measured using a luminometric technique. Figure 4 shows that the ‘control’ reporter constructs (containing the last 44 amino acids of TASK-1 and TASK-3) showed a large surface expression, whereas the ΔC1 mutants showed virtually no surface expression at all. The similarity of the effects of the ΔC1 mutants observed in the current measurements (Fig. 2) and the surface expression of the CD8 constructs (Fig. 4) Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 1.0 0.8 0.6 TASK-3 TASK-1 0.4 0.2 0 wt ∆C1 ∆C5 wt ∆C1 ∆C5 Fig. 2 Comparison of the currents measured with wild-type and ΔC1 and ΔC5 mutants of TASK-3 and TASK-1 in Xenopus oocytes. a Typical current–voltage relation of human TASK-3 (black curve) and human TASK-3ΔC1 (red curve). b Typical current–voltage relation of human TASK-1 (black curve) and human TASK-1ΔC1 (red curve). c Statistics of the relative current amplitudes measured with TASK-3, TASK-3ΔC1 and TASK-3ΔC5 (red) and with TASK-1, TASK-1ΔC1 and TASK1ΔC5 (from Zuzarte et al. [120]) suggests that 14-3-3 proteins do also interact with the last 44 amino acids of TASK-1 or TASK-3 in the CD8 reporter construct. It should be noted in this context that CD8, 14-3-3 and TASK channels are all dimeric proteins. Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 TASK-1 CT TASK-3 CT 1109 TASK-1 ∆C1 TASK-3 ∆C1 TASK-1 ∆C5 TASK-3 ∆C5 Fig. 3 Indirect immune-staining of CD8-TASK fusion proteins (original data). The entire cytosolic C-terminus of TASK-1 (upper row) or TASK-3 (lower row) was attached to the cytosolic C-terminus of CD8. The middle column shows images of the fusion proteins from which the amino acid at the extreme C-terminus was removed (ΔC1 mutants); the right column shows images of the fusion proteins from which the last five amino acids at the extreme C-terminus were removed (ΔC5 mutants). Cells were transfected using a Fugene6 (Roche), fixed with formaldehyde, permeabilized (0.05 % SDS, 0.3 % Triton X-100 in PBS) and stained with antiCD8 antibody (3030, Diatec, Norway, dilution 1:100) followed by a fluorescent secondary antibody. The scale bars are 15 μm The reason for the intracellular retention of the ΔC1 mutant was elucidated by mutagenesis on the basis of the ΔC1 mutant [120], both in TASK-1 and TASK-3 channels expressed in Xenopus oocytes, and in CD8 reporter proteins expressed in COS-7 cells. For example, the cell surface expression of the ΔC1 mutant of the CD8 construct could be rescued by mutating the two arginine residues of the MKRRKSV motif of TASK-3 to alanine [120], as illustrated in Fig. 4. Systematic mutagenesis of the C-terminal amino acids of the ΔC1 mutants revealed that the extreme Cterminus of TASK-1 and TASK-3 contains a retention signal, KRR (positions 389–391 in TASK-1 and positions 369–371 in TASK-3). Both the current measurements in oocytes and the surface expression measurements with the CD8 reporter protein constructs showed that the lysine residues of the KRR motif could not be substituted by arginine (in other words, RRR was less effective as a retention signal than the KRR signal) and none of the two arginine residues could be substituted by lysine (KKR and KRK were less effective than KRR). Thus, KRR represents a novel retention signal which differs from the canonical di-basic (RxR) retention signal and from the canonical C-terminal di-lysine (KxKxx-COOH) retention signal [120]. Since the retained ΔC1 constructs colocalised with coat protein complex COPI [120], it may be assumed that the KRR signal causes intracellular retention by activating COPI-mediated retrograde transport of TASK-1 and TASK-3. The most likely explanation for the correlation between binding of 14-3-3 proteins and TASK current density or cell surface expression is that the binding of 14-3-3 proteins masks the KRR retention signal (Fig. 1a) and in this way disinhibits the forward transport of the channel from the Golgi complex to the surface membrane. In other words, the binding motifs for 14-3-3 (RRxSx) and COPI (KRR) overlap, which makes the binding of 14-3-3 and COPI at the C-terminus of TASK-1 and TASK-3 mutually exclusive. Several crystal structures of 14-3-3 proteins are available [49, 114, 115]. The 14-3-3 dimer displays a typical W-shape with each monomer forming a central binding groove that accommodates the phosphorylated interaction motif of the TASK-1 or TASK-3 C-terminus [1]. The 14-3-3 proteins have a much lower affinity for the ΔC1 mutants [1], and the lack of 14-3-3 binding to ΔC1 constructs exposes the KRR retention signal. 1110 Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 Fig. 4 The surface expression of CD8-TASK fusion proteins measured with a luminometric technique in COS-1 cells. The fusion proteins and the amino acids at the extreme C-terminus are shown schematically on top. T3C44 represents the last 44 amino acids of TASK-3; T1C44 represents the last 44 amino acids of TASK-1. The normalised surface expression measured with the CD8-TASK-3 fusion protein (red) and the CD8-TASK-1 fusion protein (blue) and the ΔC1 and ΔC5 mutants thereof is shown in the bar graph (from Zuzarte et al. [120]) Normalised surface expressio on 1.2 1.0 0.8 0.6 0.4 0.2 0 TASK channel constructs in which the last five amino acids at the C-terminus were removed (ΔC5 mutants) were also found to be useful for understanding the mechanism of action of 14-3-3 proteins. The removal of the last five amino acids of TASK-1 or TASK-3 has the following consequences: (1) the binding of 14-3-3 proteins is abolished because the mutant does not fit into the binding groove of 14-3-3, and (2) the binding to COPI is abolished because the two arginine residues of the KRR motif are deleted. This causes a higher surface expression of the ΔC5 mutants as compared to the ΔC1 mutants. There is, however, an interesting difference in the effects of the ΔC5 mutation on the currents produced by full-length TASK-1 and TASK-3 channels on the one hand (Fig. 2) and on the surface expression of the CD8 reporter protein construct (which contained only the last 44 amino acids of the channel) on the other hand (Fig. 4): The surface expression of the ΔC5 mutant of the CD8 fusion protein was just as large as in the ‘wild-type’ construct, whereas the current amplitude produced by the ΔC5 mutants of TASK-1 and TASK-3 was reduced as compared to wild-type channels. This discrepancy may be attributable to the fact that in the intact channel the binding of 14-3-3 proteins not only masks the KRR retention signal but has additional effects on the cytosolic domains of the channel. For example, 14-3-3 protein may ‘clamp’ the cytosolic domains of the channel protein in a conformation that facilitates forward transport [98, 101]. Consistent with this interpretation, the CD8 fusion proteins used for studying subcellular localisation (which contained the entire C-terminus of TASK-1 or TASK-3) also showed a clear difference between the ‘wild-type’ construct and the ΔC5 mutant (Fig. 3). Mutation of the penultimate serine residue (S393 in human TASK-1 and S373 in human TASK-3) to alanine, mimicking the dephosphorylated state, abolished the binding of 14-3-3 and reduced surface expression and current amplitude of TASK-1 and TASK-3 in a similar way as the ΔC1 mutant [58, 76, 88, 120]. This can be explained by electrostatic interactions between the phosphate moiety of each TASK channel and positively charged side chains in the 14-3-3 binding grooves [1]. Thus, phosphorylation of the serine residue at the penultimate position is required for highaffinity binding of 14-3-3 proteins. The phosphorylation of S393 in TASK-1 and S373 in TASK-3 can be directly demonstrated by ‘phos-tag’ (NARD institute) electrophoresis [58], as illustrated in Fig. 5. O’Kelly and co-workers have shown that cAMP-dependent protein kinase and ribosomal S6 kinase (RSK2) can phosphorylate S393 of TASK-1 in vitro. These findings provide strong evidence for the notion that activation of protein kinase A via cAMP can regulate the intracellular Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 1111 Fig. 5 In vitro phosphorylation of TASK C-termini by PKA (original data). GST fusion proteins displaying the last 15 amino acids of either channel were incubated with recombinant PKA and ATP as indicated. After incubation for one hour, samples were resolved on an SDS-PAGE gel containing 100 μM Phostag reagent and 100 μM MnCl2, which retards the migration of phosphorylated residues. Constructs with both (TASK-1) or one (TASK-3) serine residue present in the distal C-terminus were analysed to demonstrate phosphorylation on the serine residues of the 14-3-3-binding motif. Mutation of these serines to alanine residues abolished phosphorylation transport of TASK-1 and TASK-3 channels to the surface membrane. Thus, the density of TASK-1 and TASK-3 currents in the cells is regulated in a very complex way (1) at the molecular level, by reduction of their open probability via Gprotein coupled receptors [65, 87, 97, 112], (2) at the transcriptional level, for example, by upregulation of transcription in cancer cells [72, 82, 113] and (3) at the posttranslational level, for example, by modulation of their intracellular traffic via production of second messengers such as cAMP [58], activation of protein kinases and subsequent binding of the switch protein 14-3-3. It should be noted here that the KRR motif is not the only retention signal identified in TASK-1 and TASK-3. Both channels have a very short N-terminus that starts with the sequence MKR (Fig. 1). It was found that replacement of the di-basic KR motif by other amino acids (e.g. NQ) markedly increased the currents produced by ‘wild-type’ TASK-1 and TASK-3 channels (and their Δ5 mutants) expressed in Xenopus oocytes and that the effect of this putative di-basic retention signal could be transferred to the reporter protein CD74 [120]. Thus, the MKR motif is a bona fide retention signal. In earlier work, it had been proposed that the binding of COPI to the N-terminal KR motif of TASK-1 or TASK-3 and the binding of 14-3-3 to the extreme C-terminus were mutually exclusive [76, 77]. This hypothesis was based on the observation that mutation of the N-terminal KR motif rescued the currents of the ΔC1 mutant. In later work, this observation could not be reproduced [120]; instead, it was found that the intracellular retention of the ΔC1 mutants was mediated by a motif (KRR) at the C-terminus of TASK-1 and TASK-3, and could not be rescued by mutation of the N-terminal KR motif [120]. The latter observations provide further support for the idea that the C-terminal retention signal (KRR), which can bind COPI, overlaps with the C-terminal 14-3-3 binding site (KRRxSx-COOH) and that this is the reason why the binding of 14-3-3 and COPI is mutually exclusive. The extreme C-terminus of TASK-5 channels also has a putative 14-3-3 binding domain (Fig. 1a) and was found to interact with 14-3-3ζ and 14-3-3ε in a yeast-two-hybrid screen [88]. Since TASK-5 channels could not be functionally expressed so far, the functional consequences of their interaction with 14-3-3 are still unknown. A puzzling finding is that TASK-5 has a polymorphism (G95E) [43, 44] that is expected to make the channel non-functional or to profoundly alter its ion selectivity. About 50 % of the tested individuals were found to be heterozygous for this mutation, and about 25 % were found to be homozygous [43]. The following observations suggest that TASK-5, despite its obstinate ‘silence’ in heterologous expression systems, may be a functional channel in vivo: (1) Chimeras of TASK-3 and TASK-5 channels produced measurable potassium currents [43]. (2) TASK-5 orthologs in various species are highly conserved. (3) TASK-5 is rather selectively and highly expressed in the auditory brain stem neurons [43]. (4) When deafness was induced in rats by ablation of the cochlea, the expression of TASK-5 in the cochlear nucleus decreased to ∼16 % of control after 3 days and to <1 % after 3 weeks [18]. Further experiments are needed to clarify the function and the subcellular localisation of TASK-5 and the possible role of 14-3-3 in regulating its intracellular traffic. A retention factor that can bind to TASK-1: the role of p11 (S100A10) The K2P-channel TASK-1 was found to interact with p11, also known as S100A10. The protein p11 is a member of the 1112 b P1 M2 M1 C2 N P1 M1 xxxKxK i20 p11 M2 P2 M4 C1 M3 C1 C2 a P2 family of S100 proteins [59]. This protein family, which has at least 25 members, consists of small, acidic proteins which are mainly localised to the cytoplasm and have no enzymatic function of their own [34]. Like 14-3-3 proteins, S100 proteins assemble as homo- or heterodimers and mainly act as switch proteins that modulate the function of client proteins [94, 103]. A common feature of all S100 proteins is that each monomer possesses two EF-hand motifs that bind calcium; calcium binding produces a conformational change which alters the function of the protein [34]. The only exception in this regard is p11 (S100A10); in this paralogue, the calciumbinding domain is not conserved, which results in a much lower calcium sensitivity. p11 is highly expressed in the brain, and its expression level is modulated by neurotransmitters, growth factors, cytokines and glucocorticoids [104]. A major interacting partner of p11 is the phospholipid-binding protein annexin A2; in addition, p11 has been shown to interact with serotonin receptors and to promote their surface expression. Knockout of p11 gave rise to a depression-like behavioural phenotype in mice, and it has been convincingly argued that alterations in the expression of p11 may play a role in the genesis of depression [104] and drug addiction [3]. The structure of p11 has been resolved [95]: each monomer possesses four alpha helices (HI to HIV); p11 forms an antiparallel dimer mainly through hydrophobic interactions between HI and HIV, as indicated in the schematic drawing of Fig. 6a (for simplicity, HII and HIII have been omitted). The interaction between TASK-1 and p11 was detected in a yeast-two-hybrid screen using the C-terminus of TASK-1 as bait and a human heart cDNA library as prey [31]. Initially, it was proposed that p11 binds to the extreme C-terminus of TASK-1 and promotes surface expression of the channel by masking the retention signal KRR [31]. This hypothesis was based, among other observations, on mutagenesis experiments which showed that the ΔC1, ΔC2 and ΔC3 mutants of TASK1 (where one, two or three residues at the extreme C-terminus, SSV, are removed) were unable to produce any currents. Later, it was found that the inability of these mutants to produce any surface expression or TASK-1 current was most likely related to the lack of binding of 14-3-3 proteins to the extreme Cterminus of TASK-1 [76, 88, 93, 120]. Thus, at least some of the results of the initial study on the effects of p11 on TASK-1 channels [31] can be explained by the effects of 14-3-3 on TASK-1 channels, which were not known at the time of publication. The idea that p11 does not bind directly to the extreme C-terminus of TASK-1 is also supported by in vitro peptide interaction experiments that suggested that the binding of p11 to TASK-1 may require prior binding of 14-3-3 proteins to the C-terminus of TASK-1 [77]. Four years after the initial study on the effects of p11 [31], it was shown that p11 binds to a region in the proximal Cterminus of TASK-1 [93], which was denoted the i20 domain because it comprises 20 amino acids. The i20 domain is not Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 M4 M3 N HIV HI HI p11 HIV KxKxxx i20 Fig. 6 Hypothetical structure of the TASK-1-p11 heterotetramer. a Schematic drawing of the antiparallel arrangement of the TASK-1 homodimer and the (hypothetical) position of the antiparallel p11 homodimer; for clarity, the two protomers of the channel have been moved apart and helices II and III of p11 have been left out. It was assumed that the TASK1-p11 heterotetramer shows a twofold symmetry. The domain on p11 to which the i20 domain of TASK-1 binds is not yet known. b The effect of removing the p11-binding domain on TASK-1 currents measured in Xenopus oocytes; in the Δi20 mutant, the p11 binding domain of TASK-1 was excised (from Renigunta et al. [93]) present in TASK-3 channels (which do not interact with p11). Removal of the i20 domain abolished the interaction between in TASK-1 and p11. Surprisingly, expression of TASK-1 channels in which the i20 domain was deleted (TASK-1Δi20 mutant) produced a much larger potassium current than wildtype TASK-1 channels (Fig. 6b). Mutagenesis experiments showed that the dependence of the amplitude of TASK-1 currents on the binding of p11 is attributable to a conserved di-lysine retention signal in the C-terminus of p11 (KxKxx(x) or HxKxx(x) [93] (Fig. 7a), which retrieves the channel to the endoplasmic reticulum as long as p11 binds to the channel. The functionality of this putative retention signal was tested using CD8-p11 fusion proteins, similar to the ones depicted in Fig. 4. The last 36 amino acids of the C-terminus of p11 were attached to CD8 (Fig. 7b), and the surface expression of this reporter construct was measured with a luminometric technique. Attachment of the last 36 amino acids of p11 abolished surface expression of the reporter construct (Fig. 7c). The surface expression could be rescued by deleting the last four amino acids of p11 and thus invalidating the retention signal (Fig. 7a, b, c). Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 a Human Rat Canis Xenopus C-terminus of p11 orthologs PLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK PLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKK PLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK PMTVDKIMKDLDDCRKGQVNFRSYCSLIAGLLIACNEYYVKHMKKR b a TASK-1 stx8 linke r A tyrosine-based endocytosis signal in the C-terminus of TASK-1: the role of syntaxin-8 The SNARE protein syntaxin-8 (stx8) was found to interact with TASK-1 in a variant of the yeast-two-hybrid screen that preferentially detects interactions with integral membrane proteins and membrane-associated protein. When full-length TASK-1 was used as a bait with a human brain cDNA library, the endosomal SNARE protein syntaxin-8 was detected as a prey [92]. This interaction was confirmed by coimmunoprecipitation of the two proteins from lysates of a mammalian cell line, without overexpression of the SNARE protein or the channel. The R-SNARE VAMP8 and the three Q-SNAREs syntaxin-8, syntaxin-7 and vti1b form the endosomal SNARE complex which is involved in fusion events in the early and late endosomal and lysosomal compartments [41]. The topology of stx8 is shown in Fig. 8a. Stx8 is a tail-anchored protein that has a transmembrane domain, a b C TMD It can be concluded from these data that binding of p11 to the proximal C-terminus of TASK-1 causes retention of the channel in the endoplasmic reticulum. Thus, p11 acts as a ‘retention factor’, and dissociation of p11 from the channel is required for efficient surface expression of the channel. Since both p11 and TASK-1 assemble as dimers, it is not unlikely that the quaternary structure of the TASK-1/p11 complex is a tetramer with twofold symmetry, as indicated schematically in the ‘functional topology’ drawing of Fig. 6a. c SNA RE m otif Fig. 7 The retention signal at the extreme C-terminus of p11. a Alignment of the C-terminus of some orthologs of p11. The histidine and lysine residues of the lysine-based retention signal, [K/H]xKxx(x), are highlighted in red. b The CD8-p11 fusion proteins used to test the functionality of the retention signal at the extreme C-terminus of p11; CD8 forms stable dimers; for simplicity only one protomer is shown. The last 36 residues acids of p11 were attached to the cytosolic C-terminus of CD8; in the mutant, the last four residues were deleted to invalidate the retention signal. c The surface expression of the two constructs shown in panel (b), as measured with a luminometric assay (from Renigunta et al. [93]) 1113 overlay Hc Hb Ha N DRRQNLL Fig. 8 The secondary structure and the subcellular localisation of syntaxin-8. a The secondary structure of stx8 including the retention signal in the linker between the Hb and Hc domains. b Co-localisation of TASK-1 (tagged with EGFP) and stx8 (tagged with DsRed monomer) in COS-7 cells 48 h after transfection (original data). The punctuate structures probably represent the early endosome 1114 a b Ra ate of endocyttosis Q-type SNARE motif [41] and three N-terminal helices Ha, Hb and Hc (a so-called Habc domain). The SNARE domain of stx8 interacts with the SNARE domains of the other three endosomal SNAREs to form the tetrahelical bundle (the transSNARE complex) that mediates fusion of the donor and acceptor membranes in the endosomal compartments. The three alpha-helices of the Habc domain interact with each other to form a ternary helical bundle which may be involved in the regulation of tethering and fusion of transport vesicles. The linker between the Hc and the SNARE domain is a flexible, unstructured region that is essential for the interaction with TASK-1 [92]. The linker between the Hb and the Hc domain contains an (atypical) lysine-based endocytosis signal: 77 DRRQNLL83 (Fig. 8a). It should be noted here that the Cterminus of TASK-1, too, contains a trafficking signal in its Cterminus: the tyrosine-based endocytosis signal 300YAEV303 (Fig. 1a). When expressed in mammalian cell lines, fluorescencelabelled TASK-1 and stx8 showed a striking co-localisation in the early endosomal compartment (Fig. 8b) [92]. Coexpression of TASK-1 channels with stx8 caused a marked reduction in TASK-1 currents, both in Xenopus oocytes and in mammalian cell lines (Fig. 9a). When both the lysine-based endocytosis signal in stx8 and the tyrosine-based endocytosis signal in TASK-1 were invalidated by mutations, the effect of stx8 on the TASK-1 current was abolished (Fig. 9a). When only one of these motifs was mutated, the effect of stx8 on TASK-1 currents was diminished [92]. The rate of endocytosis of TASK-1 channels, as measured with an antibody uptake assay, was substantially increased by co-transfection with stx8 (Fig. 9b). However, when the endocytosis signals on stx8 and TASK-1 were mutated, the rate of endocytosis was the same as under control conditions (transfection of TASK-1 alone) (Fig. 9b). A mutant of stx8 that is incapable of forming a SNARE complex had very much the same effects as wild-type stx8. Systematic mutagenesis experiments showed that the linker between the Ha helix and the SNARE motif of stx8 is essential for the interaction with TASK-1, and that the Cterminus of TASK-1 is essential for the interaction with stx8 [92]. These (and other) observations suggest that TASK-1 channels and the endosomal SNARE protein stx8 are endocytosed in a cooperative manner [92], as illustrated schematically in Fig. 10: The two proteins may bind to adjacent sites in AP-2, and endocytosis may be stimulated by simultaneous occupancy of both sites. Such a cooperative endocytosis would have a number of interesting functional implications: (1) The endosomal SNARE protein stx8 reaches its destination (the endosomal compartment) via the surface membrane. (2) Unassembled SNARE proteins can have effects unrelated to membrane fusion. (3) The endocytosis of stx8 may be modulated by TASK-1. (4) The endocytosis of TASK-1 may be modulated by stx8. (5) The cooperative endocytosis of TASK-1 and the unassembled SNARE protein Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 Fig. 9 Cooperative endocytosis of TASK-1 and stx8. a The amplitude of TASK-1 currents measured in Xenopus oocytes after expression of TASK-1 alone and after coexpression of TASK-1 and stx8. In the Y→ A mutant, the tyrosine-based endocytosis signal on TASK-1 (see Fig. 1a) was invalidated; in the LL→AA mutant, the leucine-based endocytosis signal in stx8 was invalidated. When both endocytosis signals were invalidated the effect of stx8 on TASK-1 current amplitude was abolished. b The effect of co-transfection of stx8 on the rate of endocytosis of TASK-1 channels measured in COS-7 cells using an antibody uptake assay. Co-transfection of stx8 increased the net rate of endocytosis about ninefold. When the TASK-1Y→A mutant and the stx8LL→AA mutant were co-transfected, the rate of endocytosis was no larger than under control conditions (transfection of wild-type TASK-1 alone); data from Renigunta et al. [92]) stx8 may contribute to the sorting of the channel to specific intracellular compartments. It has been suggested by several groups that the surface expression of some membrane proteins may be regulated by activation of protein kinase C [27, 39, 42]. Recently, it has been reported that activation of protein kinase C may promote endocytosis of TASK-1 channels within 15 min [29], and it has been suggested that a trafficking motif immediately downstream of the i20 domain (Fig. 1), 317SREKLQYSIP326, may play a role in this process. A similar putative endocytic motif, FREKLAYA, has been found in the neurotransmitter transporters of the SLC6 family [38]. However, the mechanisms responsible for the effect on PKC on the endocytosis of SLC6 transporters and TASK-1 and the functional role of the putative novel endocytic signal [12, 29] need further clarification. 1115 C2 C1 Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 M4 M3 otif M2 TMD P1 M1 P2 C SNA linke r C RE m N Hc Hb Ha N YAEV DRRQNLL AP-2 complex Fig. 10 Schematic diagram of the cooperative binding of the tyrosinebased endocytosis signal on TASK-1 and the leucine-based endocytosis signal on stx8 to the adaptor protein AP-2 A di-acidic ER-export signal in TASK-3: the role of Sec24 The cytosolic domains of several membrane proteins, including ion channels and G-protein coupled receptors, contain diacidic ER export motifs [7, 52–54, 56, 63, 74, 80, 107] with the consensus sequence [D/E] x [D/E], where x can be any amino acid, although in most cases analysed the export ability of D cannot be fully substituted by E and vice versa [119]. In plants, a tri-acidic ER-export motif, DxDxE, has been found [64]. The di- or tri-acidic motifs interact with the so-called Bsite of the cargo receptor Sec24 [9]. The heterodimeric complex of Sec23 and Sec24 forms the inner layer of the COPII coat, and Sec 24 serves as a receptor for cargo transported from the ER to the Golgi complex [67, 68, 71]. The interaction of proteins carrying the ER-export signals with Sec24 occurs at specific ER-export sites, where the cargo proteins are concentrated [71, 119] and the budding of transport vesicles is initiated. In a precisely orchestrated sequence of events, triggered by the small GTPase Sar1, the coat proteins Sec24, Sec23, Sec 13 and Sec31 associate to form the COPII coat complex, which exclusively mediates the vesicular transport of newly synthesised membrane proteins to the Golgi complex. In many cases, the export from the ER is rate-limiting for the transport of cargo proteins from the ER to the surface membrane. At the proximal end of the cytosolic C-terminus of human TASK-3, there is a motif consisting of eight amino acids, 252 EDERRDAE259, that may contain one or even two diacidic ER-export signals. This octapeptide motif is highly conserved in TASK-3 orthologs from insects to mammals [121]. Mutation of the proximal di-acidic motif, EDE, to ADA greatly reduced the current density and surface expression of TASK-3 in heterologous expression systems [121]. Mutation of the distal di-acidic motif, DAE, to AAA had no effect. When the C-terminus of TASK-3 was transplanted to the C-terminus of a different potassium channel, Kir2.1, the function of the EDE motif was preserved, i.e., mutation of the EDE motif to ADA reduced current amplitude and surface expression of the Kir2.1/ TASK-3 chimera [121], as illustrated in Figure 11. From these results, it was concluded that 252EDE255 is a functional ERexport signal that facilitates the export of TASK-3 from the ER. The human genome contains four isoforms of Sec24, which display differential selectivity in the export of proteins from the ER [56, 111]. The various isoforms have differential selectivity towards different variants of the [D/E]x[D/E] ER-export signal. Thus, the interaction of a specific Sec24 isoform with the EDE motif may contribute to defining the intracellular route and destination of TASK-3 channels. A very similar di-acidic motif is also found in human TASK-1 (252EDEKRDAE259) (Fig. 1a), but mutations of the acidic amino acids had no effect on TASK-1 current or surface expression (Zuzarte, Rinné, Preisig-Müller and Daut, unpublished results). This finding may be attributable to the fact that ER-export is rate-limiting for the transport of TASK-3 from the ER to the cell surface, whereas in the transport of TASK-1 to the cell surface other mechanisms are rate-limiting; the visualisation of the function of the di-acidic (EDE) motif in TASK-1 may require experiments in which the slower transport steps of TASK-1 are sidestepped. Functional implications The data presented above suggest that the intracellular traffic of TASK-3 and especially of TASK-1 channels is highly regulated. TASK-1 interacts with at least three accessory proteins: 14-3-3, p11 and syntaxin-8. A membrane yeasttwo-hybrid screen using the entire TASK-1 channels as bait 1116 Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 take place in vivo and are they physiologically relevant? In the following, we discuss this question with regard to the three interacting proteins investigated so far. HA a N ED E D AE C Relative surface exp R pression b Kir2.1-T3ct Kir2.1-T3ct Kir2.1-T3ct EDERRDAE ADARRDAE EDERRAAA Ba2+ sensitive e current c Kir2.1-T3ct Kir2 1-T3ct Kir2.1-T3ct Kir2 1-T3ct Kir2 Kir2.1-T3ct 1-T3ct EDERRDAE ADARRDAE EDERRAAA Fig. 11 The effect of the di-acidic ER-export signal of TASK-1 on inward rectifier currents. The C-terminus of TASK-3 (T3ct) was transplanted to the C-terminus of the inward rectifier K+ channel Kir2.1 (which had been truncated at position 373 to eliminate the endogenous ER-export signal of Kir2.1). a Schematic diagram of the Kir2.1/TASK-1 fusion protein with the position of the extracellular HA-tag indicated. b The surface expression of the Kir2.1/T3ct fusion protein measured in Xenopus oocytes with a luminometric technique. Mutation of the EDE motif to ADA reduced surface expression. c The potassium current produced by the Kir2.1/T3ct fusion protein expressed in Xenopus oocytes. The Kir2.1 channel blocker Ba2+ was used to define the current flowing through the Kir2.1/TASK-1 chimeric channel protein. Mutation of the EDE motif to ADA reduced current amplitude; data from Zuzarte et al. [120] yielded a large number of potential interacting proteins (n= 63), the majority of which are suspected to play a role in intracellular trafficking (Renigunta and Daut, unpublished results). There is no reason to assume that TASK-1 channels are exceptional in this respect, and it is likely that many membrane proteins have a large number of interacting proteins that influence their intracellular traffic. The major question that arises from the data presented above is: Do the interactions of TASK-1 and TASK-3 with accessory proteins The adaptor protein 14-3-3 The 14-3-3 proteins are switch proteins that have many ‘clients’ to whom they can bind depending on the phosphorylation of serine residues in the canonical 14-3-3 binding sites, and for a growing number of client proteins it has been shown that this interaction can cause profound alterations of the state of the cells [19, 30, 91, 101]. Therefore, especially in view of the large effect of 14-3-3 binding on the surface expression of TASK-1 and TASK-3, it is very likely that this interaction is functionally relevant. Further corroboration of this tenet will depend on antibodies capable of detecting and purifying native TASK channels. For native ATP-sensitive potassium channels (KATP-channels), a correlation between their cell surface expression and the abundance of 14-3-3 proteins has been demonstrated in primary cardiac myocytes [2]. Given that 14-3-3 proteins are bound to TASK channels with a much higher affinity than to KATP-channels, TASK-1 channels represent an attractive system to study the effects of 14-3-3 on membrane protein trafficking in native cardiomyocytes. A major obstacle for our understanding of the action of 14-3-3 in vivo is the fact that these proteins interact with a multitude of clients and that the precise affinity and abundance of the interaction partners is usually unknown. The situation calls for a more quantitative investigation of 14-3-3-client interactions so that correlations between binding parameters and biological effect can be analysed in detail. In addition, drugs that perturb 14-3-3client interaction such as derivatives of the fungal toxin fusicoccin A [1, 69] will be invaluable to query the relevance of such as interactions in vivo. The adaptor protein p11 The functional role of the interaction between p11 and TASK-1 is not yet clear; the affinity of the binding of p11 to TASK-1 has not been determined and the free cytosolic concentrations of p11 are not known. However, it has been shown that the surface expression of TASK-1 channels is markedly increased in the TASK-1Δi20 mutant (in which the p11 binding domain has been deleted), both in mammalian cell lines and in Xenopus oocytes. This suggests that endogenous p11 is present in the cytosol at sufficient concentration to trap a fraction of the TASK-1 channels in the endoplasmic reticulum. TASK-1 is strongly expressed in neurons in many areas of the brain [105]. The expression of p11 (S100A10) is regulated in various brain regions by growth factors such as brain-derived neurotrophic factor (BDNF) and cytokines such as interferon γ and tumour necrosis factor β (TGFβ), and by glucocorticoids. Furthermore, the mRNA coding for p11 is upregulated by treatment with various antidepressant drugs [104], and p11 knockout mice show a depression-like behaviour. Therefore, p11 has been Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 proposed to be a potential target for antidepressant therapy [104]. It is tempting to speculate that some of the antidepressant effects of p11 might be mediated by its interaction with TASK-1, causing a reduction of TASK-1 current density in neurons. The SNARE protein syntaxin-8 The interaction between syntaxin-8 and TASK-1 has been demonstrated by coimmunoprecipitation in a cell line endogenously expressing both proteins [92]. This finding suggests that the interaction may also take place in vivo and is not a mere consequence of the overexpression (which was required to elucidate the mechanisms of action of stx8). SNARE proteins, together with Rab GTPases and phosphoinositides, play an important role in defining the identity of intracellular compartments [6, 20, 55, 62, 86]. They are involved in specific membrane fusion processes and thus contribute to shaping the intracellular itinerary of membrane proteins. The notion that unassembled SNARE proteins have functions unrelated to membrane fusion is relatively new and needs further confirmation. There are indications that SNARE proteins may also modulate the intracellular traffic of ion channels other than TASK-1 [10, 11, 16, 26, 47], but in most cases the mechanisms by which the SNARE proteins affect vesicular transport have remained unclear. The cooperative endocytosis of syntaxin-8 and TASK-1 links the itinerary of a SNARE protein to that of a cargo molecule. In other words, the presence of stx8 might influence the sorting decisions of TASK-1 and vice versa. This may turn out to be a prototypic protein–protein interaction that provides specificity to the itinerary and fate of membrane proteins. It should be noted here that only few SNARE proteins, including syntaxin-8 and syntaxin-6, have a classical linear endocytosis signal. However, several monomeric SNARE proteins have unconventional binding sites linking them to coat components or coat adaptor proteins involved in intracellular transport (including Sec24, AP180, CALM and Hrb) [56, 57, 60, 85]; these binding sites are distinct from the canonical linear motifs and are defined by the tertiary structure of the SNARE proteins. In these cases, too, the binding of disassembled SNARE proteins to specific vesicles may provide a mechanism for pre-determining subsequent transport steps [60]. Conclusions The K2P-channels TASK-1 and TASK-3 provide an illustrative example of how protein–protein interactions may control the life cycle of membrane proteins. It has been proposed that all cells possess a trafficking proteostasis network (TPN) that manages the folding of proteins and their transport between intracellular compartments [40]. It is likely that membrane 1117 proteins encounter many interacting proteins during their passage through different compartments and that some of these interactions influence subsequent sorting decisions. Membrane proteins obviously have multiple binding sites for interacting proteins, both in their unstructured regions and in structured domains [51, 57]. Interacting proteins may modulate the intracellular traffic of their ‘clients’ by three types of mechanisms: (1) The binding of the interacting protein may mask canonical trafficking signals (whose number keeps expanding). (2) The interacting proteins may themselves carry trafficking signals by which they modulate the sorting decisions of their clients [93]. (3) The interacting proteins may influence the folding of their clients, which again might expose or mask trafficking signals or influence intracellular traffic of their clients in some other way [40]. In conclusion, interacting proteins may adapt the complex itinerary of a protein within the cell to the specific functions of that protein; thus, the binding sites for specific interacting proteins might be regarded as trafficking motifs in the wider sense. Acknowledgments This study was supported by the Deutsche Forschungsgemeinschaft (FOR 1086, TP7 and TP9; SFB 593, TP4). References 1. Anders C, Higuchi Y, Koschinsky K, Bartel M, Schumacher B, Thiel P, Nitta H, Preisig-Müller R, Schlichthorl G, Renigunta V, Ohkanda J, Daut J, Kato N, Ottmann C (2013) A semisynthetic fusicoccane stabilizes a protein-protein interaction and enhances the expression of K+ channels at the cell surface. Chem Biol 20:583– 593 2. Arakel EC, Brandenburg S, Uchida K, Zhang H, Lin YW, Kohl T, Schrul B, Sulkin MS, Efimov IR, Nichols CG, Lehnart SE, Schwappach B (2014) Tuning the electrical properties of the heart by differential trafficking of KATP ion channel complexes. J Cell Sci 127:2106–2119 3. Arango-Lievano M, Schwarz JT, Vernov M, Wilkinson MB, Bradbury K, Feliz A, Marongiu R, Gelfand Y, Warner-Schmidt J, Nestler EJ, Greengard P, Russo SJ, Kaplitt MG (2014) Cell-type specific expression of p11 controls cocaine reward. Biol Psychiatry 76:794–801 4. Ashmole I, Goodwin PA, Stanfield PR (2001) TASK-5, a novel member of the tandem pore K+ channel family. Pflugers Arch 442: 828–833 5. Bayliss DA, Barrett PQ (2008) Emerging roles for two-pore-domain potassium channels and their potential therapeutic impact. Trends Pharmacol Sci 6. Behnia R, Munro S (2005) Organelle identity and the signposts for membrane traffic. Nature 438:597–604 7. Bi X, Corpina RA, Goldberg J (2002) Structure of the Sec23/24Sar1 pre-budding complex of the COPII vesicle coat. Nature 419: 271–277 8. Bichet D, Blin S, Feliciangeli S, Chatelain FC, Bobak N, Lesage F (2014) Silent but not dumb: how cellular trafficking and pore gating modulate expression of TWIK1 and THIK2. Pflugers Arch 9. Bickford LC, Mossessova E, Goldberg J (2004) A structural view of the COPII vesicle coat. Curr Opin Struct Biol 14:147–153 1118 10. Bilan F, Nacfer M, Fresquet F, Norez C, Melin P, Martin-Berge A, Costa de Beauregard MA, Becq F, Kitzis A, Thoreau V (2008) Endosomal SNARE proteins regulate CFTR activity and trafficking in epithelial cells. Exp Cell Res 314:2199–2211 11. Bilan F, Thoreau V, Nacfer M, Derand R, Norez C, Cantereau A, Garcia M, Becq F, Kitzis A (2004) Syntaxin 8 impairs trafficking of cystic fibrosis transmembrane conductance regulator (CFTR) and inhibits its channel activity. J Cell Sci 117:1923–1935 12. Boudanova E, Navaroli DM, Stevens Z, Melikian HE (2008) Dopamine transporter endocytic determinants: Carboxy terminal residues critical for basal and PKC-stimulated internalization. Mol Cell Neurosci 39:211–217 13. Brohawn SG, Campbell EB, MacKinnon R (2013) Domainswapped chain connectivity and gated membrane access in a Fabmediated crystal of the human TRAAK K+ channel. Proc Natl Acad Sci U S A 110:2129–2134 14. Brohawn SG, del Marmol J, MacKinnon R (2012) Crystal structure of the human K2P TRAAK, a lipid- and mechano-sensitive K+ ion channel. Science 335:436–441 15. Calhoun JD, Isom LL (2014) The role of non-pore-forming beta subunits in physiology and pathophysiology of voltage-gated sodium channels. Handb Exp Pharmacol 221:51–89 16. Chen PC, Bruederle CE, Gaisano HY, Shyng SL (2011) Syntaxin 1A regulates surface expression of beta-cell ATP-sensitive potassium channels. Am J Physiol Cell Physiol 300:C506–C516 17. Conner SD, Schmid SL (2003) Regulated portals of entry into the cell. Nature 422:37–44 18. Cui YL, Holt AG, Lomax CA, Altschuler RA (2007) Deafness associated changes in two-pore domain potassium channels in the rat inferior colliculus. Neuroscience 149:421–433 19. de Boer AH, van Kleeff PJ, Gao J (2013) Plant 14-3-3 proteins as spiders in a web of phosphorylation. Protoplasma 250:425–440 20. Di Paolo G, De Camilli P (2006) Phosphoinositides in cell regulation and membrane dynamics. Nature 443:651–657 21. Dolphin AC (2009) Calcium channel diversity: Multiple roles of calcium channel subunits. Curr Opin Neurobiol 19:237–244 22. Duprat F, Lesage F, Fink M, Reyes R, Heurteaux C, Lazdunski M (1997) TASK, a human background K+ channel to sense external pH variations near physiological pH. EMBO J 16:5464–5471 23. Ellis RJ (2013) Assembly chaperones: a perspective. Philos Trans R Soc Lond B Biol Sci 368:20110398 24. Ellis RJ (2006) Molecular chaperones: Assisting assembly in addition to folding. Trends Biochem Sci 31:395–401 25. Enyedi P, Czirjak G (2010) Molecular background of leak K+ currents: Two-pore domain potassium channels. Physiol Rev 90: 559–605 26. Feinshreiber L, Chikvashvili D, Michaelevski I, Lotan I (2009) Syntaxin modulates Kv1.1 through dual action on channel surface expression and conductance. Biochemistry 48:4109–4114 27. Feng J, Cai X, Zhao J, Yan Z (2001) Serotonin receptors modulate GABA(A) receptor channels through activation of anchored protein kinase C in prefrontal cortical neurons. J Neurosci 21:6502–6511 28. Fu H, Subramanian RR, Masters SC (2000) 14-3-3 proteins: Structure, function, and regulation. Annu Rev Pharmacol Toxicol 40:617–647 29. Gabriel L, Lvov A, Orthodoxou D, Rittenhouse AR, Kobertz WR, Melikian HE (2012) The acid-sensitive, anesthetic-activated potassium leak channel, KCNK3, is regulated by 14-3-3beta-dependent, protein kinase C (PKC)-mediated endocytic trafficking. J Biol Chem 287:32354–32366 30. Gardino AK, Yaffe MB (2011) 14-3-3 proteins as signaling integration points for cell cycle control and apoptosis. Semin Cell Dev Biol 22:688–695 31. Girard C, Tinel N, Terrenoire C, Romey G, Lazdunski M, Borsotto M (2002) p11, an annexin II subunit, an auxiliary protein associated with the background K+ channel, TASK-1. EMBO J 21:4439–4448 Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 32. Gong W, Zhou D, Ren Y, Wang Y, Zuo Z, Shen Y, Xiao F, Zhu Q, Hong A, Zhou X, Gao X, Li T (2008) PepCyber:P∼PEP: a database of human protein protein interactions mediated by phosphoproteinbinding domains. Nucleic Acids Res 36:D679–D683 33. Gonzalez C, Baez-Nieto D, Valencia I, Oyarzun I, Rojas P, Naranjo D, Latorre R (2012) K+ channels: Function-structural overview. Compr Physiol 2:2087–2149 34. Gross SR, Sin CG, Barraclough R, Rudland PS (2014) Joining S100 proteins and migration: for better or for worse, in sickness and in health. Cell Mol Life Sci 71:1551–1579 35. Hamill OP, Marty A, Neher E, Sakmann B, Sigworth FJ (1981) Improved patch-clamp techniques for high-resolution current recording from cells and cell-free membrane patches. Pflugers Arch 391:85–100 36. Hartl FU (1996) Molecular chaperones in cellular protein folding. Nature 381:571–579 37. Hartl FU, Bracher A, Hayer-Hartl M (2011) Molecular chaperones in protein folding and proteostasis. Nature 475:324–332 38. Holton KL, Loder MK, Melikian HE (2005) Nonclassical, distinct endocytic signals dictate constitutive and PKC-regulated neurotransmitter transporter internalization. Nat Neurosci 8:881–888 39. Hu K, Huang CS, Jan YN, Jan LY (2003) ATP-sensitive potassium channel traffic regulation by adenosine and protein kinase C. Neuron 38:417–432 40. Hutt DM, Balch WE (2013) Expanding proteostasis by membrane trafficking networks. Cold Spring Harb Perspect Med 3:1–21 41. Jahn R, Scheller RH (2006) SNAREs—Engines for membrane fusion. Nat Rev Mol Cell Biol 7:631–643 42. Kanda VA, Purtell K, Abbott GW (2011) Protein kinase C downregulates IKs by stimulating KCNQ1-KCNE1 potassium channel endocytosis. Heart Rhythm 8:1641–1647 43. Karschin C, Wischmeyer E, Preisig-Müller R, Rajan S, Derst C, Grzeschik KH, Daut J, Karschin A (2001) Expression pattern in brain of TASK-1, TASK-3, and a tandem pore domain K+ channel subunit, TASK-5, associated with the central auditory nervous system. Mol Cell Neurosci 18:632–648 44. Kim D, Gnatenco C (2001) TASK-5, a new member of the tandempore K+ channel family. Biochem Biophys Res Commun 284:923– 930 45. Kim Y, Bang H, Kim D (2000) TASK-3, a new member of the tandem pore K+ channel family. J Biol Chem 275:9340–9347 46. Lesage F, Barhanin J (2011) Molecular physiology of pHsensitive background K2P channels. Physiology (Bethesda) 26: 424–437 47. Leung YM, Kang Y, Gao X, Xia F, Xie H, Sheu L, Tsuk S, Lotan I, Tsushima RG, Gaisano HY (2003) Syntaxin 1A binds to the cytoplasmic C terminus of Kv2.1 to regulate channel gating and trafficking. J Biol Chem 278:17532–17538 48. Li X, Garrity AG, Xu H (2013) Regulation of membrane trafficking by signalling on endosomal and lysosomal membranes. J Physiol 591:4389–4401 49. Liu D, Bienkowska J, Petosa C, Collier RJ, Fu H, Liddington R (1995) Crystal structure of the zeta isoform of the 14-3-3 protein. Nature 376:191–194 50. Ma D, Jan LY (2002) ER transport signals and trafficking of potassium channels and receptors. Curr Opin Neurobiol 12:287– 292 51. Ma D, Taneja TK, Hagen BM, Kim BY, Ortega B, Lederer WJ, Welling PA (2011) Golgi export of the Kir2.1 channel is driven by a trafficking signal located within its tertiary structure. Cell 145: 1102–1115 52. Ma D, Zerangue N, Lin YF, Collins A, Yu M, Jan YN, Jan LY (2001) Role of ER export signals in controlling surface potassium channel numbers. Science 291:316–319 53. Ma D, Zerangue N, Raab-Graham K, Fried SR, Jan YN, Jan LY (2002) Diverse trafficking patterns due to multiple traffic motifs in Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 54. 55. 56. 57. 58. 59. 60. 61. 62. 63. 64. 65. 66. 67. 68. 69. 70. 71. 72. 73. G protein-activated inwardly rectifying potassium channels from brain and heart. Neuron 33:715–729 Malkus P, Jiang F, Schekman R (2002) Concentrative sorting of secretory cargo proteins into COPII-coated vesicles. J Cell Biol 159: 915–921 Malsam J, Kreye S, Söllner TH (2008) Membrane fusion: SNAREs and regulation. Cell Mol Life Sci 65:2814–2832 Mancias JD, Goldberg J (2008) Structural basis of cargo membrane protein discrimination by the human COPII coat machinery. EMBO J 27:2918–2928 Mancias JD, Goldberg J (2007) The transport signal on Sec22 for packaging into COPII-coated vesicles is a conformational epitope. Mol Cell 26:403–414 Mant A, Elliott D, Eyers PA, O’Kelly IM (2011) Protein kinase A is central for forward transport of two-pore domain potassium channels K2P3.1 and K2P9.1. J Biol Chem 286:14110–14119 Marenholz I, Heizmann CW, Fritz G (2004) S100 proteins in mouse and man: from evolution to function and pathology (including an update of the nomenclature). Biochem Biophys Res Commun 322: 1111–1122 Maritzen T, Koo SJ, Haucke V (2012) Turning CALM into excitement: AP180 and CALM in endocytosis and disease. Biol Cell 104: 588–602 McMahon HT, Boucrot E (2011) Molecular mechanism and physiological functions of clathrin-mediated endocytosis. Nat Rev Mol Cell Biol 12:517–533 McNew JA, Parlati F, Fukuda R, Johnston RJ, Paz K, Paumet F, Sollner TH, Rothman JE (2000) Compartmental specificity of cellular membrane fusion encoded in SNARE proteins. Nature 407: 153–159 Mikosch M, Hurst AC, Hertel B, Homann U (2006) Diacidic motif is required for efficient transport of the K+ channel KAT1 to the plasma membrane. Plant Physiol 142:923–930 Mikosch M, Kaberich K, Homann U (2009) ER export of KAT1 is correlated to the number of acidic residues within a triacidic motif. Traffic 10:1481–1487 Millar JA, Barratt L, Southan AP, Page KM, Fyffe RE, Robertson B, Mathie A (2000) A functional role for the two-pore domain potassium channel TASK-1 in cerebellar granule neurons. Proc Natl Acad Sci U S A 97:3614–3618 Miller AN, Long SB (2012) Crystal structure of the human two-pore domain potassium channel K2P1. Science 335:432–436 Miller E, Antonny B, Hamamoto S, Schekman R (2002) Cargo selection into COPII vesicles is driven by the Sec24p subunit. Embo J 21:6105–6113 Miller EA, Beilharz TH, Malkus PN, Lee MC, Hamamoto S, Orci L, Schekman R (2003) Multiple cargo binding sites on the COPII subunit Sec24p ensure capture of diverse membrane proteins into transport vesicles. Cell 114:497–509 Milroy LG, Brunsveld L, Ottmann C (2013) Stabilization and inhibition of protein-protein interactions: the 14-3-3 case study. ACS Chem Biol 8:27–35 Milroy LG, Grossmann TN, Hennig S, Brunsveld L, Ottmann C (2014) Modulators of protein-protein interactions. Chem Rev 114: 4695–4748 Mossessova E, Bickford LC, Goldberg J (2003) SNARE selectivity of the COPII coat. Cell 114:483–495 Mu D, Chen L, Zhang X, See LH, Koch CM, Yen C, Tong JJ, Spiegel L, Nguyen KC, Servoss A, Peng Y, Pei L, Marks JR, Lowe S, Hoey T, Jan LY, McCombie WR, Wigler MH, Powers S (2003) Genomic amplification and oncogenic properties of the KCNK9 potassium channel gene. Cancer Cell 3:297–302 Musset B, Meuth SG, Liu GX, Derst C, Wegner S, Pape HC, Budde T, Preisig-Muller R, Daut J (2006) Effects of divalent cations and spermine on the K+ channel TASK-3 and on the outward current in thalamic neurons. J Physiol 572:639–657 1119 74. Nishimura N, Balch WE (1997) A di-acidic signal required for selective export from the endoplasmic reticulum. Science 277: 556–558 75. O’Kelly I (2014) Endocytosis as a mode to regulate functional expression of two-pore domain potassium (K2P ) channels. Pflügers Archiv European Journal of Physiology 76. O’Kelly I, Butler MH, Zilberberg N, Goldstein SA (2002) Forward transport. 14-3-3 binding overcomes retention in endoplasmic reticulum by dibasic signals. Cell 111:577–588 77. O’Kelly I, Goldstein SA (2008) Forward transport of K(2P)3.1: Mediation by 14-3-3 and COPI, modulation by p11. Traffic 9:72–78 78. Obsil T (2011) 14–3–3 proteins–a family of universal scaffolds and regulators. Semin Cell Dev Biol 22:661–662 79. Obsilova V, Kopecka M, Kosek D, Kacirova M, Kylarova S, Rezabkova L, Obsil T (2014) Mechanisms of the 14-3-3 protein function: Regulation of protein function through conformational modulation. Physiol Res 63(Suppl 1):S155–S164 80. Otte S, Barlowe C (2004) Sorting signals can direct receptormediated export of soluble proteins into COPII vesicles. Nat Cell Biol 6:1189–1194 81. Ottmann C (2013) Small-molecule modulators of 14-3-3 proteinprotein interactions. Bioorg Med Chem 21:4058–4062 82. Pei L, Wiser O, Slavin A, Mu D, Powers S, Jan LY, Hoey T (2003) Oncogenic potential of TASK3 (KCNK9) depends on K+ channel function. Proc Natl Acad Sci U S A 100:7803–7807 83. Pfeffer SR (2011) Entry at the trans-face of the Golgi. Cold Spring Harb Perspect Biol 3 84. Pongs O, Schwarz JR (2010) Ancillary subunits associated with voltage-dependent K+ channels. Physiol Rev 90:755–796 85. Pryor PR, Jackson L, Gray SR, Edeling MA, Thompson A, Sanderson CM, Evans PR, Owen DJ, Luzio JP (2008) Molecular basis for the sorting of the SNARE VAMP7 into endocytic clathrin-coated vesicles by the ArfGAP Hrb. Cell 134:817–827 86. Pucadyil TJ, Schmid SL (2009) Conserved functions of membrane active GTPases in coated vesicle formation. Science 325:1217– 1220 87. Putzke C, Wemhöner K, Sachse FB, Rinné S, Schlichthörl G, Li XT, Jae L, Eckhardt I, Wischmeyer E, Wulf H, Preisig-Müller R, Daut J, Decher N (2007) The acid-sensitive potassium channel TASK-1 in rat cardiac muscle. Cardiovasc Res 75:59–68 88. Rajan S, Preisig-Müller R, Wischmeyer E, Nehring R, Hanley PJ, Renigunta V, Musset B, Schlichthörl G, Derst C, Karschin A, Daut J (2002) Interaction with 14-3-3 proteins promotes functional expression of the potassium channels TASK-1 and TASK-3. J Physiol 545: 13–26 89. Rajan S, Preisig-Müller, R., Wischmeyer, E., Nehring, R., Daut, J., Karschin, A. & Derst, C. (2002) A C-terminal pentapeptide motif interacting with 14-3-3 protein strongly enhances cell surface expression of TASK-1, a 2P domain K+ channel. Biophys J 82:201a202a (abstract; January 2002) 90. Rajan S, Wischmeyer E, Liu GX, Preisig-Müller R, Daut J, Karschin A, Derst C (2000) TASK-3, a novel tandem pore domain acid-sensitive K+ channel. an extracellular histidine as pH sensor. J Biol Chem 275:16650–16657 91. Reinhardt HC, Yaffe MB (2013) Phospho-Ser/Thr-binding domains: Navigating the cell cycle and DNA damage response. Nat Rev Mol Cell Biol 14:563–580 92. Renigunta V, Fischer T, Zuzarte M, Kling S, Zou X, Siebert K, Limberg MM, Rinne S, Decher N, Schlichthörl G, Daut J (2014) Cooperative endocytosis of the endosomal SNARE protein syntaxin-8 and the potassium channel TASK-1. Mol Biol Cell 25: 1877–1891 93. Renigunta V, Yuan H, Zuzarte M, Rinné S, Koch A, Wischmeyer E, Schlichthörl G, Gao Y, Karschin A, Jacob R, Schwappach B, Daut J, Preisig-Müller R (2006) The retention factor p11 confers an 1120 94. 95. 96. 97. 98. 99. 100. 101. 102. 103. 104. 105. 106. 107. Pflugers Arch - Eur J Physiol (2015) 467:1105–1120 endoplasmic reticulum-localization signal to the potassium channel TASK-1. Traffic 7:168–181 Rescher U, Gerke V (2008) S100A10/p11: Family, friends and functions. Pflugers Arch 455:575–582 Rety S, Sopkova J, Renouard M, Osterloh D, Gerke V, Tabaries S, Russo-Marie F, Lewit-Bentley A (1999) The crystal structure of a complex of p11 with the annexin II N-terminal peptide. Nat Struct Biol 6:89–95 Rinné S, Renigunta V, Schlichthörl G, Zuzarte M, Bittner S, Meuth SG, Decher N, Daut J, Preisig-Müller R (2014) A splice variant of the two-pore domain potassium channel TREK-1 with only one pore domain reduces the surface expression of full-length TREK-1 channels. Pflugers Arch 466:1559–1570 Schiekel J, Lindner M, Hetzel A, Wemhöner K, Renigunta V, Schlichthörl G, Decher N, Oliver D, Daut J (2013) The inhibition of the potassium channel TASK-1 in rat cardiac muscle by endothelin-1 is mediated by phospholipase C. Cardiovasc Res 97: 97–105 Schwappach B (2008) An overview of trafficking and assembly of neurotransmitter receptors and ion channels (Review). Mol Membr Biol 25:270–278 Seet BT, Dikic I, Zhou MM, Pawson T (2006) Reading protein modifications with interaction domains. Nat Rev Mol Cell Biol 7: 473–483 Shikano S, Coblitz B, Sun H, Li M (2005) Genetic isolation of transport signals directing cell surface expression. Nat Cell Biol 7: 985–992 Smith AJ, Daut J, Schwappach B (2011) Membrane proteins as 143-3 clients in functional regulation and intracellular transport. Physiology (Bethesda) 26:181–191 Stauber T, Weinert S, Jentsch TJ (2012) Cell biology and physiology of CLC chloride channels and transporters. Compr Physiol 2: 1701–1744 Svenningsson P, Greengard P (2007) p11 (S100A10)—an inducible adaptor protein that modulates neuronal functions. Curr Opin Pharmacol 7:27–32 Svenningsson P, Kim Y, Warner-Schmidt J, Oh YS, Greengard P (2013) p11 and its role in depression and therapeutic responses to antidepressants. Nat Rev Neurosci 14:673–680 Talley EM, Solorzano G, Lei Q, Kim D, Bayliss DA (2001) Cns distribution of members of the two-pore-domain (KCNK) potassium channel family. J Neurosci 21:7491–7505 Veale EL, Rees KA, Mathie A, Trapp S (2010) Dominant negative effects of a non-conducting TREK1 splice variant expressed in brain. J Biol Chem 285:29295–29304 Venditti R, Wilson C, De Matteis MA (2014) Exiting the ER: what we know and what we don’t. Trends Cell Biol 24:9–18 108. Wagner MJ, Stacey MM, Liu BA, Pawson T (2013) Molecular mechanisms of SH2- and PTB-domain-containing proteins in receptor tyrosine kinase signaling. Cold Spring Harb Perspect Biol 5: a008987 109. Welling PA (2013) Regulation of potassium channel trafficking in the distal nephron. Curr Opin Nephrol Hypertens 22: 559–565 110. Welling PA, Weisz OA (2010) Sorting it out in endosomes: an emerging concept in renal epithelial cell transport regulation. Physiology (Bethesda) 25:280–292 111. Wendeler MW, Paccaud JP, Hauri HP (2007) Role of Sec24 isoforms in selective export of membrane proteins from the endoplasmic reticulum. EMBO Rep 8:258–264 112. Wilke BU, Lindner M, Greifenberg L, Albus A, Kronimus Y, Bünemann M, Leitner MG, Oliver D (2014) Diacylglycerol mediates regulation of TASK potassium channels by Gq-coupled receptors. Nat Commun 5:5540 113. Williams S, Bateman A, O’Kelly I (2013) Altered expression of two-pore domain potassium (K2P) channels in cancer. PLoS ONE 8: e74589 114. Xiao B, Smerdon SJ, Jones DH, Dodson GG, Soneji Y, Aitken A, Gamblin SJ (1995) Structure of a 14-3-3 protein and implications for coordination of multiple signalling pathways. Nature 376:188– 191 115. Yaffe MB, Rittinger K, Volinia S, Caron PR, Aitken A, Leffers H, Gamblin SJ, Smerdon SJ, Cantley LC (1997) The structural basis for 14-3-3:phosphopeptide binding specificity. Cell 91:961–971 116. Yu FH, Yarov-Yarovoy V, Gutman GA, Catterall WA (2005) Overview of molecular relationships in the voltage-gated ion channel superfamily. Pharmacol Rev 57:387–395 117. Zerangue N, Schwappach B, Jan YN, Jan LY (1999) A new ER trafficking signal regulates the subunit stoichiometry of plasma membrane KATP channels. Neuron 22:537–548 118. Zhang J, Yan J (2014) Regulation of BK channels by auxiliary gamma subunits. Front Physiol 5:401 119. Zhang X, Dong C, Wu QJ, Balch WE, Wu G (2011) Di-acidic motifs in the membrane-distal C termini modulate the transport of angiotensin II receptors from the endoplasmic reticulum to the cell surface. J Biol Chem 286:20525–20535 120. Zuzarte M, Heusser K, Renigunta V, Schlichthörl G, Rinné S, Wischmeyer E, Daut J, Schwappach B, Preisig-Müller R (2009) Intracellular traffic of the K+ channels TASK-1 and TASK-3: role of N- and C-terminal sorting signals and interaction with 14-3-3 proteins. J Physiol 587:929–952 121. Zuzarte M, Rinné S, Schlichthörl G, Schubert A, Daut J, PreisigMüller R (2007) A di-acidic sequence motif enhances the surface expression of the potassium channel TASK-3. Traffic 8:1093–1100