Download Endocrine Notes - Cleveland Clinic

Survey
yes no Was this document useful for you?
   Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Document related concepts

Fetal origins hypothesis wikipedia , lookup

Epidemiology of metabolic syndrome wikipedia , lookup

History of intersex surgery wikipedia , lookup

Transcript
C l e v e l a n d C l inic R E SOUR C E G u i d e
Physician Directory
Referring Physician Center
CME Opportunities: Live & Online
View all Cleveland Clinic staff
For help with service-related issues,
online at clevelandclinic.org/staff.
information about our clinical special-
Outcomes Data
ists and services, details about CME
Cleveland Clinic’s Center for Continuing
Education’s website offers convenient,
complimentary learning opportunities,
from patient simulations, webcasts and
podcasts to a host of medical publications and a schedule of live CME courses.
Physicians can manage CME credits
using the myCME.com Web portal
available 24/7. Visit ccfcme.org.
View the latest clinical Outcomes
books from Cleveland Clinic’s Endocrinology & Metabolism Institute at
opportunities and more, email
refdr@ccf.org, or call 216.448.0900
or 888.637.0568.
clevelandclinic.org/quality/outcomes.
EMI Referrals
Endocrinology & Metabolism Institute
216.444.6568 or 800.223.2273, ext. 46568
Bariatric Surgery
216.445.2224 or 800.223.2273, ext. 52224
F o r Y o u r P a tient s
DrConnect is a secure online service providing our physician colleagues with real-time information about the
treatment their patients receive at Cleveland Clinic. To
receive your next patient report electronically, establish
a DrConnect account at clevelandclinic.org/drconnect.
Complimentary assistance for out-of-state patients
and families: 800.223.2273, ext. 55580, or email
medicalconcierge@ccf.org.
Complimentary assistance for national and international
patients and families: 001.216.444.8184 or visit
MyChart
®
Cleveland Clinic MyChart® is a secure, online personal healthcare management tool that connects patients to portions of
their medical record at any time of day or night. Patients may
view test results, renew prescriptions, review past appointments and request new ones. A new feature, Schedule My
216.445.2547 or 800.223.2273, ext. 52547
open schedule and make appointments online in real time.
Appointment, allows patients to view their primary physician’s
Patients may register for MyChart® through their physician’s
office or by going online to ccf.org/mychart.
Cleveland Clinic’s critical care transport teams and fleet of
mobile ICU vehicles, helicopters and fixed-wing aircraft serve
critically ill and highly complex patients across the globe. Transport is available for children and adults. To arrange a transfer
for STEMI (ST elevated myocardial infarction), acute stroke, ICH
(intracerebral hemorrhage), SAH (subarachnoid hemorrhage)
or aortic syndromes, call 877.379.CODE (2633). For all other
critical care transfers, call 216.448.7000 or 866.547.1467
or visit clevelandclinic.org/criticalcaretransport.
Cleveland Clinic’s Diabetes & Endocrinology Program is ranked 5th in the
nation in U.S.News & World Report’s annual America’s Best Hospitals survey.
Updates for physicians on practices, advances and research
from Cleveland Clinic’s Endocrinology & Metabolism Institute
clevelandclinic.org /ic.
Request Medical Records
Critical Care Transport Worldwide
Endocrine Notes
Medical Concierge
Global Patient Services
Track Your
Patient’s Care Online
The Cleveland Clinic Foundation
Endocrinology & Metabolism Institute
Endocrine Notes
9500 Euclid Avenue / AC311
Cleveland, OH 44195
11-END-008
In This Issue:
2New Entity: Primary Hyperparathyroidism with Normal PTH
4A Rare Case of Acromegaly Diagnosed During Pregnancy
6Robotic Approach Preferred for Adrenalectomy
8 STAMPEDE Substudy Asks Whether Gastric Bypass
Reverses Beta Cell Dysfunction
9STAMPEDE II Study Now Enrolling Patients
10Bariatric Surgery Now Standard Treatment for Morbidly
Obese Diabetic Patients
11Gastric Plication Holds Promise for Extreme Weight Loss
12Adult Growth Hormone Deficiency: Study Compares
Glucagon Stimulation Test to Insulin Tolerance Test
14Publications
18 Live and Online CME
19Current Clinical Trials
20Staff Directory
2011
Endocrinology & Metabolism Institute | Staff Directory
Contact Us
General Patient Referral
24/7 hospital transfers or physician
consults – 800.553.5056
Endocrinology & Metabolism Institute
Appointments/Referrals
216.444.6568 or 800.223.2273,
ext. 46568
Bariatric Surgery
Appointments/Referrals
216.445.2224 or 800.223.2273,
ext. 52224
On the Web at
clevelandclinic.org/endonotes
Endocrinology &
Metabolic Institute
Locations
Main Campus
9500 Euclid Ave./F20
Cleveland, Ohio 44195
216.444.6568
Endocrinology & Metabolic
Institute Diabetes Center
10685 Carnegie Ave.
Cleveland, Ohio 44106
216.444.6568
Ashtabula County Medical Center
2420 Lake Ave.
Cleveland, Ohio 44404
440.997.6969
Cleveland Clinic Beachwood
Family Health and Surgery Center
26900 Cedar Road
Beachwood, Ohio 44122
216.839.3000
Cleveland Clinic Independence
Family Health Center
5001 Rockside Road
Crown Center II
Independence, Ohio 44131
216.986.4000
Cleveland Clinic Lorain
Family Health and Surgery Center
5700 Cooper Foster Park Road
Lorain, Ohio 44053
440.204.7400
Cleveland Clinic Solon
Family Heath Center
29800 Bainbridge Road
Solon, Ohio 44139
440.519.6800
Cleveland Clinic Willoughby
Hills Family Health Center
2570 SOM Center Road
Willoughby Hills, Ohio 44094
440.943.2500
Cleveland Clinic Wooster
Family Health Center
1740 Cleveland Road
Wooster, Ohio 44691
330.287.4500
Lakewood Hospital
Professional Building
14601 Detroit Road
Lakewood, Ohio 44107
216.529.5300
Medina Hospital
Professional Building
4087 Medina Road, Ste. 400
Medina, Ohio 44256
330.725.3713
Cleveland Clinic Stephanie
Tubbs Jones Health Center
13944 Euclid Ave.
East Cleveland, Ohio 44112
216.767.4242
Cleveland Clinic Strongsville Family
Health and Surgery Center
16761 SouthPark Center
Strongsville, Ohio 44136
440.878.2500
Cleveland Clinic Twinsburg Family
Health and Surgery Center
8701 Darrow Road
Twinsburg, Ohio 44087
330.888.4000
South Pointe Charles Miner
Medical Building
20600 Harvard Road
Warrensville Heights, Ohio 44122
216.295.1010
Cleveland Clinic Florida
2950 Cleveland Clinic Blvd.
Weston, Fla. 33331
877.463.2010
Endocrine Notes
Chairman, Endocrinology & Metabolism Institute
James B. Young, MD
Endocrine Notes updates physicians on clinical practices, advances and research from Cleveland Clinic’s
Managing Editor
Cora M. Liderbach
Endocrinology & Metabolism Institute. It is written for
Art Director
Mike Viars
purposes only. It does not provide a complete overview of
Marketing
Bill Sattin, PhD
Mary Anne Connor
physicians and should be relied upon for medical education
the topics covered and should not replace the independent
judgment of a physician about the appropriateness or risks
of a procedure for a given patient.
© 2011 The Cleveland Clinic Foundation
Leila Khan, MD
Specialty Interest(s): General endocrinology,
diabetes, calcium/bone disorders
Location(s): Main campus; Willoughby Hills
Family Health Center
Office: 216.445.1598 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Willoughby Hills, 440.943.2500
Leann Olansky, MD
Specialty Interest(s): Diabetes and diabetes complications, gestational diabetes, general endocrinology
Location(s): Main campus; Stephanie Tubbs Jones
Health Center
Office: 216.444.2642 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Stephanie Tubbs Jones Health Center, 216.767.4242
M. Cecilia Lansang, MD, MPH
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus
Office: 216.445.5246 | Fax: 216.445.1656
Appointments: 216.444.6568
Richard Shewbridge, MD
Specialty Interest(s): Endocrinology, diabetes, thyroid
disorders, hyperlipidemia, osteoporosis
Location(s): Medina
Office: 330.725.3713 | Fax: 330.725.2141
Appointments: 330.725.3713
Melissa Li-Ng, MD
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus; Solon Family Health Center
Office: 216.444.1949 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Solon, 440.519.6800
Vinni Makin, MD
Specialty Interest(s): General endocrinology,
diabetes, hirsutism, acne, thyroid disorders
Location(s): Main campus; Solon Family Health Center
Office: Main campus, 216.444.0539;
Solon, 440.519.6800 | Fax: Main campus,
216.445.1656; Solon, 440.519.6908
Appointments: Main campus, 216.444.6568;
Solon, 440.519.6800
Adi Mehta, MD
Specialty Interest(s): Diabetes mellitus, thyroid
disorders, gynecologic endocrinology, endocrine
complications of pregnancy, menopause, lipid
disorders, general and adolescent endocrinology
Location(s): Main campus; Beachwood Family
Health Center (Reproductive Endocrinology only)
Office: 216.445.5312 | Fax: 216.445.7261
Appointments: Main campus, 216.444.6568;
Beachwood, 216.839.3000
Guy Mulligan, MD
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus; Twinsburg Family Health
and Surgery Center; South Pointe/Charles Miner
Medical Building
Office: 330.888.4000 | Fax: 330.963.4561
Appointments: Main Campus, 216.444.6568;
Twinsburg, 330.888.4000; South Pointe,
216.295.1010
Mario Skugor, MD
Co-director, Thyroid Center
Associate Director, Endocrinology Fellowship Program
Specialty Interest(s): Osteoporosis and calcium
metabolism, obesity and diabetes, multiple endocrine
neoplasia syndromes, thyroid disorders, thyroid cancer
Location(s): Main campus
Office: 216.445.0739 | Fax: 216.445.1656
Appointments: 216.444.6568
David Shewmon, MD
Specialty Interest(s): General endocrinology, diabetes,
high cholesterol, osteomalacia, osteoporosis, pituitary
tumors, thyroid conditions, thyroid cancer
Location(s): Wooster Family Health Center
Office: 330.287.4690 | Fax: 330.287.4876
Appointments: 330.287.4690
Mariam Stevens, MD
Specialty Interest(s): Diabetes, gestational diabetes,
goiter, Graves’ disease, Hashimoto’s disease, hirsutism,
hyperthyroidism, hypoglycemia, hypothyroidism,
polycystic ovary syndrome, thyroid disease,
thyroid nodule
Location(s): Independence Family Health Center
Office: 216.986.4000 | Fax: 216.986.4995
Appointments: 216.986.4000
Robert Zimmerman, MD
Director, Cleveland Clinic Diabetes Center
Vice Chairman, Department of Endocrinology, Diabetes
and Metabolism
Program Director, Endocrinology Training Program
Specialty Interest(s): Diabetes, thyroid disorders, growth
hormone in adults
Location(s): Main campus
Office: 216.444.9428 | Fax: 216.445.1656
Appointments: 216.444.6568
Department of Endocrine Surgery
Bariatric and Metabolic Institute
Eren Berber, MD
Director, Robotic Endocrine Surgery
Specialty Interest(s): Endocrine surgery (thyroid and
parathyroid), laparoscopic solid-organ surgery, advanced
laparoscopic surgery, laparoscopic radiofrequency
ablation of liver tumors, pancreatic neuroendocrine
tumors, robotic thyroid and parathyroid surgery,
laparoscopic and robotic adrenalectomy and liver surgery
Location(s): Main campus
Office: 216.445.0555 | Fax: 216.636.0662
Appointments: 216.444.6568
Kresimira (Mira) Milas, MD
Director, Thyroid Center
Specialty Interest(s): Endocrine surgery (thyroid
and parathyroid), thyroid cancer, multiple endocrine
neoplasia syndromes, hereditary thyroid disorders
Location(s): Main campus
Office: 216.444.4985 | Fax: 216.636.0662
Appointments: 216.444.6568
Jamie Mitchell, MD
Specialty Interest(s): Endocrine surgery (thyroid,
parathyroid and adrenal), laparoscopic solid organ
surgery, advanced laparoscopic surgery, laparoscopic
radiofrequency ablation of liver tumors
Location(s): Main campus; Independence Family Health
Center; Solon Family Health Center
Office: 216.445.9713 | Fax: 216.636.0662
Appointments: Main campus, 216.444.6568;
Independence, 216.986.4000; Solon, 440.519.6800
Joyce J. Shin, MD
Specialty Interest(s): Endocrine surgery (thyroid and
parathyroid), advanced laparoscopic surgery, laparoscopic
adrenalectomy, neuroendocrine tumors, thyroid/parathyroid
ultrasound, intra-abdominal ultrasound, laparoscopic
radiofrequency thermal ablation of liver tumors
Location(s): Main campus; Willoughby Hills
Family Health Center
Office: 216.636.9365 | Fax: 216.636.0662
Appointments: Main campus, 216.444.6568;
Willoughby Hills, 440.943.2500
Allan Siperstein, MD
Department Chair
Specialty Interest(s): Endocrine surgery (thyroid and
parathyroid), advanced laparoscopic surgery, laparoscopic
adrenalectomy, laparoscopic thermal ablation of liver
tumors, pancreatic endocrine tumors
Location(s): Main campus
Office: 216.444.5664 | Fax: 216.636.0662
Appointments: 216.444.6568
Christian Nasr, MD
Co-director, Thyroid Center
Specialty Interest(s): Thyroid nodules, thyroid
cancers, flushing syndromes
Main campus; Lorain Family Health and Surgery Center
(Thyroid cancer only)
Office: 216.445.1788 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Lorain, 440.204.7400
Stacy Brethauer, MD
Specialty Interest(s): Bariatric surgery, laparoscopic surgery,
gastrointestinal surgery, hernia repair, endoscopy, surgery for
GERD, hiatal hernia, solid-organ endoluminal surgery,
single-incision laparoscopic surgery
Location(s): Main campus
Office: 216.444.9244 | Fax: 216.445.1586
Appointments: 216.445.2224
Derrick Cetin, DO
Specialty Interest(s): Bariatric medicine, medical weight
management, nutrition sciences, obesity management,
preoperative evaluation, diabetes care
Location(s): Main Campus
Office: 216.445.4255 | Fax: 216.636.1588
Appointments: 216.445.2224
Bipan Chand, MD
Specialty Interest(s): Advanced laparoscopy and endoscopy,
endoscopy in the obese patient, gastric surgery focusing on
reflux disease, hiatal hernia, bariatric operations and gastric
cancer, biliary and spleen surgery, natural orifice transluminal
endoscopic surgery (NOTES), endoluminal surgery
Location(s): Main campus
Office: 216.444.6668 | Fax: 216.445.1586
Appointments: 216.445.2224
Karen Cooper, DO
Specialty Interest(s): Bariatric medicine, family medicine,
kinesiology and nutrition sciences, exercise instruction
Location(s): Main campus
Office: 216.445.1114 | Fax: 216.445.1586
Appointments: 216.445.2224
Matthew Kroh, MD
Specialty Interest(s): Advanced laparoscopic surgery,
bariatric surgery, gastrointestinal surgery, endoscopy,
single-incision laparoscopic surgery
Location(s): Main campus
Office: 216.445.9966 | Fax: 216.444.2153
Appointments: 216.445.2224
Tomasz Rogula, MD, PhD
Specialty Interest(s): Advanced laparoscopic surgery,
bariatric surgery, gastrointestinal surgery, endoscopy,
single-incision laparoscopic surgery
Location(s): Main campus; Strongsville Family Health
and Surgery Center
Office: 216.445.0255 | Fax: 216.445.1586
Appointments: Main campus: 216.445.2224;
Strongsville: 440.878.2500
Philip Schauer, MD
Department Chair
Specialty Interest(s): Bariatric surgery, laparoscopic surgery,
gastrointestinal surgery, colon surgery, weight management,
hernia surgery, biliary surgery, surgery for GERD
Location(s): Main campus
Office: 216.444.4794 | Fax: 216.445.1586
Appointments: 216.445.2224
Visit clevelandclinic.org/EndoStaff for the most current staff listings and locations.
Dear Colleagues,
I am pleased to present the 2011 edition of Endocrine Notes from Cleveland Clinic’s
Endocrinology & Metabolism Institute.
Inside, we offer highlights from our multidisciplinary team’s most recent work:
• Our report on a new parathyroid disease entity: primary hyperparathyroidism
with normal PTH levels.
• A rare case of acromegaly that was diagnosed during pregnancy.
• A report on our experience with robotic adrenalectomy, which has become
the preferred surgical approach.
• A STAMPEDE substudy examining the clinical and metabolic factors involved
in remission and non-remission of diabetes after gastric bypass surgery.
• Information about the STAMPEDE II trial.
• The designation of bariatric surgery as a first-line treatment for type 2 diabetes in the
morbidly obese and the promise that gastric plication holds for drastic weight reduction.
• A study evaluating the glucagon stimulation test as an alternative to the insulin
tolerance test for determining growth hormone deficiency in adults.
The Endocrinology & Metabolism Institute is one of 26 Cleveland Clinic institutes that group
related specialties together to provide integrated, patient-centered care. Collaboration among
endocrinologists, endocrine surgeons, bariatricians, bariatric surgeons and a cardiologist allows
us to transcend the traditional borders between disciplines to improve patient care.
Throughout our institute, our staff remains committed to Cleveland Clinic’s core ideology:
“Patients First.” Our institute comprises:
• The Department of Endocrinology, Diabetes and Metabolism, which manages specialized
centers of care for patients with diabetes, thyroid disorders and pituitary disorders.
• The Department of Endocrine Surgery, which performs the highest number of surgical
procedures in the region.
• The Bariatric and Metabolic Institute, which has been designated a Bariatric Surgery
Center of Excellence by the American Society for Metabolic and Bariatric Surgery.
I hope that you find this issue of Endocrine Notes useful for your practice. Your comments
and questions are always welcome. Please feel free to contact me at 216.444.6568 or
800.223.2273, ext. 46568.
Sincerely,
James B. Young, MD
Chairman, Endocrinology & Metabolism Institute
Professor of Medicine and Executive Dean,
Cleveland Clinic Lerner College of Medicine of Case Western Reserve University
George and Linda Kaufman Chair
Physician Director, Institutional Relations and Development
800.223.2273,
Endocrine Notes ext. 46568
|1|
clevelandclinic.org/endonotes
2011
Primary Hyperparathyroidism
With Normal PTH Levels:
A Modern Parathyroid Disease Entity
Primary hyperparathyroidism (PHP) is not rare. One percent of the population and 2 percent of women
over age 55 develop this condition. When they do, they normally manifest the classical picture of high
calcium and high parathyroid hormone (PTH) measurements in the blood. But atypical presentations
are becoming more appreciated; a case in point is normocalcemic PHP. Ten percent of patients will have
normal calcium levels and high PTH, making PHP hard to differentiate from other causes of elevated PTH.
In Cleveland Clinic’s Department of Endocrine Surgery, we
$QXQXVXDOÀQGLQJ
have described another entity of PHP, which we have desig-
We conducted a review of 843 patients who had undergone
nated normohormonal primary hyperparathyroidism (NHPHP).
initial bilateral parathyroid exploration at Cleveland Clinic
Patients with this entity have high calcium levels but normal-
between January 2005 and December 2010. Of the study
to-low PTH levels – as low as 5 pg/mL. Knowledge of this
population, 46 patients (5.5 percent) were found to have
subgroup may help the diagnosis of PHP to be made earlier.
We feel it is appropriate to accept this atypical biochemistry
SURÀOHLQWKHIDFHRIDQRWKHUZLVHTXLWHXVXDO3+3SUHVHQtation. These patients have clearly enlarged parathyroids,
preoperative iPTH values within the normal reference range
(10-60 mg/mL at Cleveland Clinic, or the normal range
at the testing laboratory). All 46 had hypercalcemia, with
values up to 12.5 mg/dL.
NLGQH\VWRQHVDQGRVWHRSRURVLVDV\RXZRXOGÀQGLQD
A review of medical histories found that PHP had been
classical patient. This is a real subtype of the disease.
discovered incidentally in 74 percent of patients. However,
70 percent had at least one symptom of PHP, 50 percent
had abnormal bone density studies, 17 percent had a history
3DUDWK\URLG6XUJHU\
of nephrolithiasis, and 37 percent reported neuropsychiatric
symptoms such as fatigue, irritability, altered mood, poor
concentration or declining memory. None had a family history
of PHP or hypercalcemia. Preoperative localization studies
accurately detected parathyroid disease in 80 percent.
6XEJURXSVLGHQWLÀHG
The study also noted three subgroups of NHPHP:
‡ 6XEJURXS, consisted of 7 patients with preoperative iPTH
values < 40 pg/mL, the lowest measuring 5 pg/mL.
‡ 6XEJURXS,, consisted of 19 patients, all having
SUHRSHUDWLYHL37+YDOXHV”SJP/
3UHDQG3RVWRSHUDWLYHL37+9DOXHVDPRQJ
3DWLHQWVZLWK1+3+3DQG7\SLFDO3+3
(YLGHQFHIRU/RZHU37+6HW3RLQWVLQ1+3+3
‡ 6XEJURXS,,, consisted of 20 patients who occasionally
demonstrated iPTH values > 60 pg/mL, even though most
ZHUH”SJP/
Endocrine Notes
|2|
2011
By Mira Milas, MD, and
Lucy B. Wallace, MD
Other than the preoperative iPTH values, there were no
VWDWLVWLFDOO\VLJQLÀFDQWGLIIHUHQFHVDPRQJWKHVHVXEJURXSVRU
3+3FRYHUVDEURDGVSHFWUXPRIODERUDWRU\YDOXHV
LQFOXGLQJSDWLHQWVZLWKQRUPDOFDOFLXPOHYHOV$
DQGZLWKQRUPDO37+OHYHOV1+3+3
classical PHP patients for any of the following features: age,
gender, degree of hypercalcemia, 24-hour urinary calcium
value and vitamin D levels, rate of parathyroid adenoma
(74 percent) versus multi-gland disease (24 percent), and
size of abnormal parathyroids. All NHPHP patients had
resolution of hypercalcemia following surgery.
diagnosis of PHP. NHPHP patients had multiple additional
data points of serum calcium and iPTH before proceeding
to surgery. Some were given more elaborate tests, such as
A few distinct subgroup differences are interesting to
PTHrp measurement, SPEP, selective venous sampling or CT
highlight. For example, patients in subgroups I and II were
scanning to evaluate for malignancy. The additional testing
more commonly diagnosed by the endocrine surgeon after
did not elucidate other etiologies of hypercalcemia, and all
being referred for thyroid disease, as compared with patients
patients had PHP.
who had higher iPTH values. Subgroup I had the lowest
prevalence of bone loss and neuropsychiatric symptoms.
Preoperative localization studies failed to detect abnormal
parathyroid glands more often in patients with lower iPTH
values, despite a similar prevalence of parathyroid adenomas
and abnormal gland volumes.
$GLVWLQFWSKHQRW\SH
Given such differences among the subgroups, we initially
wondered whether we were simply diagnosing PHP at an
Having performed this study and having this data to reference, we are comfortable recommending an imaging workup
DQGVXUJHU\WR1+3+3SDWLHQWVZKRÀWWKHK\SHUSDUDWK\URLG
GLVHDVHSURÀOH:HGRQRWDVVXPHWKDWRWKHUFDXVHVRI
hypercalcemia will be more likely so that expensive additional
tests will be mandatory for all. However, we believe that
additional testing should be performed selectively based on
an individual patient’s medical history.
The study suggests that when patients have high calcium
earlier phase of disease evolution. However, when we found
levels but iPTH levels < 60 pg/mL and even < 40 pg/mL,
similar degrees of hypercalcemia, morphology of parathyroid
the diagnosis of primary hyperparathyroidism should be
disease and abnormal gland volume among all subgroups,
considered, particularly if no other etiology of hypercalcemia
we became convinced that NHPHP is a real entity – a
FDQEHLGHQWLÀHG$OWKRXJKDPLQRULW\RISDWLHQWVKDYHWKLV
distinct phenotype of PHP.
SURÀOHWKH\DUHKLJKO\OLNHO\WRKDYHDSDUDWK\URLGWXPRU
In our publication, we suggest several possible explanations for
the NHPHP phenomenon. One hypothesis is derived from PTH
patterns before and after surgery (illustrated in the graph on
page 2.) These patterns suggest that some patients may have
parathyroids that simply function at a lower “set-point” for PTH.
and surgery is curative.
$ERXWWKHDXWKRUV
Dr. Milas is Director of the Thyroid Center; Dr. Wallace worked
with her and other Cleveland Clinic endocrine surgeons on this
study as a fellow in the Department of Endocrine Surgery.
)XUWKHUWHVWVRUGHUHGWKRXJKWIXOO\
At Cleveland Clinic, the usual practice is to proceed to
For more information, please contact Dr. Milas at
VXUJHU\RQFHWZRVHWVRIODERUDWRU\GDWDFRQÀUPWKH
216.444.4985 or at milasm@ccf.org.
800.223.2273, ext. 46568
|3|
clevelandclinic.org/endonotes
A Rare Case of Acromegaly
Diagnosed During Pregnancy
Pregnancy in patients with acromegaly is rare, with less than 150 cases
reported in the literature. Currently, there are no guidelines regarding the
diagnosis or management of acromegaly during pregnancy.
The diagnosis and monitoring of acromegaly during pregnancy are complicated
by the presence of a placental growth hormone (GH) source, resulting in
physiologic changes in pituitary GH secretion and insulin-like growth factor-1
(IGF-1) production. Commercial assays cannot distinguish between pituitary
GH and placental GH.
Fertility is decreased in women with acromegaly due to altered gonadotropin
secretion, but the following case illustrates that when pregnancy does occur, its
outcome is usually favorable. Metabolic complications are uncommon, and most
patients do not experience an increase in the size of their pituitary adenomas.
&DVHKLVWRU\DQGSUHVHQWDWLRQ
A 30-year old woman, G2P1, 13 weeks’ gestation, was referred to specialists in
Cleveland Clinic’s Endocrinology & Metabolism Institute and Ob/Gyn & Women’s
Health Institute. She presented with clinical features suggestive of acromegaly,
including worsening headache, coarse facial features, acne, increased jawline,
and enlargement of the hands and feet over two years. The IGF-1 level of
816 ng/mL was elevated (nonpregnant reference range: 138-410). A pregnancy
two years earlier was uneventful.
The labs revealed a prolactin of 99 ng /mL (2.0-17.4); a repeat IGF-1 of
1,085 ng/mL; and basal and nadir GH of 13.9 and 12.8 ng/mL, respectively,
during oral glucose tolerance testing. Glucose levels, blood pressure and visual
field tests were normal. Pituitary MRI without contrast revealed a 1.5 cm
macroadenoma with no impingement on the optic chiasm.
0DQDJLQJV\PSWRPVGXULQJSUHJQDQF\
Severe headache prompted therapy, but the patient was unable to tolerate the
dopamine receptor agonist bromocriptine. She was then started on 50 μg of the
Endocrine Notes
|4|
2011
By Vicky Cheng, MD, and Laurence Kennedy, MD
somatostatin analog octreotide every eight hours at 19
weeks’ gestation, which resulted in significant headache
relief and clinical improvement. The IGF-1 level decreased
to 671 ng/mL and remained relatively stable during the
rest of the pregnancy, while the GH level progressively
increased, peaking at 43.9 ng/mL at 33 weeks’ gestation.
At 38 ½ weeks’ gestation, the patient delivered a healthy
baby girl (3355 g). Breastfeeding was unsuccessful due
to lack of milk production. At one week postpartum, while
the patient remained on octreotide, the GH level declined
inexplicably to 1.13 ng/mL. At four weeks postpartum,
the GH and IGF-1 levels were 15.2 ng/mL and 1090
ng/mL, respectively.
are unaffected. Even without treatment, research to date
shows that little change in the size of pituitary adenomas
and no worsening of visual fields during pregnancy are to
be expected.
Scheduling surgery after delivery
Pituitary MRI at four weeks postpartum showed that the
Dopamine agonists and somatostatin analogs appear to be
patient’s adenoma was stable. She underwent transsphe-
safe during pregnancy, but because safety data are sparse,
noidal resection of the adenoma, which immunostained
their usage is generally reserved for symptomatic patients.
positively for GH, but surgery failed to achieve a biochemical cure. Postoperatively, the GH level was 7.5 ng/mL,
and the IGF-1 level was 892 ng/mL. She was started on
a long-acting somatostatin analog.
The use of the GH receptor antagonist pegvisomant seems
promising during pregnancy when somatostatin analogs
and surgery fail to control tumor growth. However, experience with pegvisomant is extremely limited, so its use will
Treatment considerations during pregnancy
require further study.
As was true for this patient, the majority of pregnancies in
Surgery can be safely postponed until after delivery for
patients with acromegaly are uneventful, and newborns
most patients except when it is needed in an emergency
for acute visual loss or pituitary apoplexy.
IMAGING
Imaging
About the authors
Dr. Cheng worked on this case as a fellow in the Department of
MRI of the pituitary without contrast
revealed a macroadenoma measuring
Endocrinology, Diabetes and Metabolism with Laurence Kennedy, MD,
MRI
of the
pituitary
1.0
x 1.5
x 1.0
cm with no
Chair, and endocrinologists Amir Hamrahian, MD, Charles Faiman, MD,
without contrast
impingement
of the optic chiasm
and Betul Hatipoglu, MD; and with obstetrician Fadi Khoury, MD.
revealed a
macroadenoma
that measured
1.0 x 1.5 x 1.0 cm
with no impingement of the optic
chiasm.
For further information, contact Dr. Hamrahian at
216.445.8538 or hamraha@ccf.org, or Dr. Kennedy at
216.445.8645 or kennedl4@ccf.org.
Based on poster presentation at American Association of Clinical Endocrinologists (AACE)
20th Annual Meeting and Clinical Congress, San Diego, Calif., April 13-17, 2011.
800.223.2273, ext. 46568
|5|
clevelandclinic.org/endonotes
Robotic Surgery
Now the Preferred Approach to Adrenalectomy
After several years’ experience in performing
endocrine surgeon Eren Berber, MD, below, who
robotic adrenalectomies, Cleveland Clinic endo-
spearheads the technology and is training other-
crine surgeons have found that robotic surgery
Endocrinology & Metabolism Institute surgeons.
provides significant advantages over conven-
“Moreover, when we compared the robotic series
tional laparoscopy. To date, they have performed
with past laparoscopies, it became clear that
more than 71 robotic adrenalectomies with no
the duration of the surgery was similar, if not
complications and no mortality.
shorter, despite removing larger tumors.
“Increased dexterity from articulating instruments
and 3-D vision makes dissection faster and easier.
As a result, we are able to remove larger tumors
minimally invasively that would have otherwise
required an open operation,” says Cleveland Clinic
“We also noticed a trend toward a shorter hospital stay. Overall, both immediate postoperative
pain and length of stay were slightly less with
the robotic approach.”
Robot ideal for posterior approach
Additionally, robotic technology has enabled the surgeons
to refine the posterior approach, which Dr. Berber and his
colleagues were first in the world to describe.
“Rigid laparoscopic instruments made the procedure cumbersome, but the articulated instrumentation provided by the
robot makes the operation more ergonomic,” he explains.
“With the robot, we have fewer instrument collisions and
can reach difficult angles more easily.
“Although the posterior approach is technically more demanding, we prefer it over the lateral transabdominal approach.
Because we do not enter the intra-abdominal cavity, patients
have less postoperative pain and may recover faster.”
The surgeons especially favor the posterior approach in
certain patients with bilateral tumors or significant abdominal
scarring. However, they prefer the lateral transabdominal
approach for patients with thicker back tissue or with
tumors larger than 6 cm.
The robotic approach also compares favorably to the
laparoscopic approach in posterior procedures. “Posterior
Endocrine Notes
|6|
2011
The posterior robotic approach avoids the intra-abdominal cavity, reduces immediate postoperative pain and shortens length of stay.
robotic adrenalectomy is about 30 minutes faster than
These procedures are performed through axillary incisions
posterior laparoscopic adrenalectomy,” notes Dr. Berber.
to eliminate visible scarring on the neck.
Large volume of adrenal procedures
Tracking adrenal tumor patients’ outcomes
Cleveland Clinic’s volume of adrenal operations is one of
Data from all adrenal tumor patients is entered into an
the largest in the world, notes Dr. Berber, who believes that
IRB-approved registry that is used to evaluate outcomes
a comprehensive adrenal surgery program should offer
and compare surgical options. The registry, started in 2000,
a variety of surgical options.
now contains information on 300 cases.
Open adrenalectomy is available for tumors that have
Dr. Berber directs a weekly multidisciplinary adrenal diseases
invaded surrounding structures. Dr. Berber and colleagues
clinic with Cleveland Clinic endocrinologists and radiologists.
also offer radiofrequency ablation, a technique they pioneered in the treatment of adrenal tumors. Patients with
unresectable tumors and patients too sick for surgery are
ideal candidates for radiofrequency ablation.
Other robotic procedures offered
Cleveland Clinic endocrine surgeons offer a comprehensive
spectrum of surgical procedures, including robotic alternaDissection during a robotic adrenalectomy.
tives. For example, besides robotic adrenalectomy, Cleveland
Clinic endocrine surgeons have amassed one of the largest
experiences with robotic thyroidectomy and robotic parathyroidectomy in the United States.
800.223.2273, ext. 46568
To refer patients for evaluation or for further information,
please contact Dr. Berber at 216.445.0555 or at
berbere@ccf.org.
|7|
clevelandclinic.org/endonotes
STAMPEDE Substudy Examines Factors
Underlying Diabetes Remission or Non-Remission
Bariatric surgery is now widely accepted for the
treatment of severe obesity, with approximately
200,000 procedures performed in the United
States yearly. With more than 50 percent of type 2
GLDEHWHVPHOOLWXV'0SDWLHQWVFODVVLÀHGDVREHVH
DQGSHUFHQWFODVVLÀHGDVPRUELGO\REHVHEDULDWULF
surgery has tremendous therapeutic potential.
“Weight loss is a key component in the resolution of type 2 DM,
“Data from this study, in conjunction with clinical trial data,
and bariatric surgery can be highly effective in inducing
ZLOODOORZXVWRGHÀQHPHWDEROLFDGDSWDWLRQVZLWKUHVSHFWWR
weight loss,” says Cleveland Clinic endocrinologist Sangeeta
changes in intestinal hormones and fat-generated hormones
Kashyap, MD. “However, DM does not always resolve with
following various bariatric procedures.”
bariatric surgery, even with optimal weight loss.”
This will help to further understanding of the potential bariat-
A Cleveland Clinic study, Surgical Therapy and Medications
ric surgery holds for the treatment of DM in moderate obesity.
3RWHQWLDOO\(UDGLFDWH'LDEHWHV(IÀFLHQWO\STAMPEDE), is
The study may also be useful in establishing appropriate
FRPSDULQJWKHHIÀFDF\DQGVDIHW\RI5RX[HQ<JDVWULF
expectations, because patients with DM expect their disease
bypass surgery, sleeve gastrectomy and advanced medical
to resolve following bariatric surgery.
WKHUDS\LQUHVWRULQJQRUPDOEORRGJOXFRVHOHYHOV+E$F”
percent) among diabetic patients who are moderately obese
=HURLQJLQRQLQFUHWLQELRORJ\
(BMI 27-43 Kg/m2). Philip Schauer, MD, Director of the
After surgery, not all patients are likely to achieve com-
Bariatric and Metabolic Institute (pictured above), is
plete remission. Dr. Kashyap believes this may be due to
principal investigator.
poor baseline residual B-cell function and a lack of incretin
/RRNLQJIRUXQGHUO\LQJIDFWRUV
STAMPEDELVUHDIÀUPLQJWKHYDOXHRIEDULDWULFSURFHGXUHV
in helping many patients achieve glycemic control, yet a
number of patients have been unable to achieve or maintain
stimulation induced by either procedure. It is currently
unclear whether weight loss alone or incretin-related effects
on B-cell function is the dominant mechanism related to
long-term DM remission.
DM remission despite dramatic weight loss. This prompted Dr.
“Given their potential to enhance insulin secretion, promote
Kashyap to launch a substudy of STAMPEDE, funded by the
B-cell growth and induce weight loss, understanding the dif-
American Diabetes Association, to examine the clinical and
ferential response of incretin hormones to the various bariatric
metabolic factors determining DM non-remission after either
procedures in patients who achieve DM remission versus
Roux-en-Y gastric bypass or sleeve gastrectomy.
non-remission is critical,” she says.
“As endocrinologists, we need to understand which patients
The ability of bariatric surgery to reverse DM may depend on
ZLOOEHQHÀWPRVWIURPEDULDWULFVXUJHU\LQRUGHUWRRSWLPL]H
disease duration and severity. Patients with recent-onset DM
patient selection and determine the point at which surgery
and mild hyperglycemia who do not require insulin are likely
should be recommended,” says Dr. Kashyap.
to have the greatest baseline B-cell function. Those with poor
Endocrine Notes
|8|
2011
STAMPEDE II
Now Enrolling
residual B-cell function at baseline may not experience the
IXOOEHQHÀWRILQFUHWLQVWLPXODWLRQDQGZHLJKWORVVUHODWHG
improvements in insulin sensitivity and thus achieve only
partial remission or nonremission.
:HLJKWUHJDLQDOVRFRQVLGHUHG
A second issue to evaluate is the effect of weight regain on
DM. Although most patients experience substantial weight
loss in the 12 months following bariatric surgery, weight
regain beginning in year two does occur in some patients.
Dr. Kashyap hopes to determine how weight regain leads to
non-response by establishing the weight-related effects on
lipotoxicity-mediated insulin resistance 12 and 24 months
following bariatric surgery.
Cleveland Clinic is currently enrolling patients for the
Lipotoxicity plays a central role in inducing B-cell dysfunction
STAMPEDE II (Surgical Therapy and Medications Potentially
and insulin resistance, which lead to the development of DM.
Eradicate Diabetes Efficiently) study. The randomized,
Therefore, “the impact of bariatric surgery on the weight-
controlled trial will examine short- and long-term outcomes of
related and non-weight-related effects of lipotoxicity must be
advanced medical therapy versus advanced medical therapy
determined in patients achieving longer-term, complete DM
combined with Roux-en-Y gastric bypass.
remission versus non-remission,” she says. “Since weight
The effect of each approach on disease progression,
regain is associated with an increase in fat mass, we expect
to see a direct impact of weight regain on impairing insulin
complications and organ damage will be evaluated. Sixty
sensitivity and glucose tolerance.”
men and women with type 2 diabetes are sought for the
One-year outcomes for the study will be available in 2012,
and have a body mass index between 27 and 43 kg/m2.
study. Candidates must be between 20 and 60 years of age
and two-year outcomes will be available in 2013.
Co-investigators for STAMPEDE II are Philip Schauer, MD,
Director of the Cleveland Clinic Bariatric and Metabolic
Institute; Sangeeta Kashyap, MD, of the Department of
Endocrinology, Diabetes and Metabolism; and John Kirwan,
PhD, of the departments of Gastroenterology and Hepatology,
and Pathobiology.
For more information about STAMPEDE II,
call 800.223.2273, ext. 53983,
or visit clinicaltrials.gov.
For more information, please contact Dr. Kashyap (above) at
216.445.2679 or at kashyas@ccf.org.
800.223.2273, ext. 46568
|9|
clevelandclinic.org/endonotes
Bariatric Surgery Now Standard Treatment
for Morbidly Obese Diabetic Patients
In March 2011, the International Diabetes Federation (IDF) issued
a position statement upgrading bariatric surgery from an option
to a priority for morbidly obese patients (BMI > 35 kg/m2) with
type 2 diabetes mellitus (DM).
“The value of bariatric procedures in helping morbidly
obese patients achieve glycemic control has been conÀUPHG,WLVWLPHIRUPHWDEROLFVXUJHU\WREHDQDFFHSWHG
option, because diabetes in severely obese patients is often
refractory to conventional therapy with insulin and oral
agents, due to severe insulin resistance,” explains Philip
Schauer, MD, Director of the Cleveland Clinic Bariatric and
Metabolic Institute and a member of the IDF expert panel
that authored the position statement.
The IDF statement also says that patients with a BMI of
30–35 kg/m2 should be considered for surgery when
hemoglobin A1c is > 7.5 percent despite optimal therapy,
and particularly if weight is increasing or in the presence
of other weight-responsive co-morbidities that are not
achieving targets using conventional therapies, including
hypertension, dyslipidemia and obstructive sleep apnea.
The IDF writing group reviewed the data related to other
conventional, standard bariatric operations and novel
interventional procedures and considered gastric banding
(above left), sleeve gastrectomy (above middle), gastric bypass
(Roux-en-Y, above right), biliopancreatic diversion and
duodenal switch in its clinical recommendations.
Endocrine Notes
| 10 |
2011
Gastric Plication Holds Promise
for Extreme Weight Loss
Gastric plication, called laparoscopic greater curvature plication (LGCP)
when performed laparoscopically, is a promising investigational bariatric
procedure that may be useful in achieving weight loss and metabolic
goals with very low morbidity.
Neither the stomach nor intestines are removed, enabling the
plication to be reversed or converted to another procedure at
a later time, if desired. The entire procedure can be completed
in less than one hour. Most patients leave the hospital after a
few hours in recovery and can return to work within seven to
10 days. Problems are rare, and major complications occur in
fewer than 1 percent of cases.
LGCP is considered investigational as a primary procedure
for weight loss and is being offered to patients at Cleveland
&OLQLFDVSDUWRIDFOLQLFDOWULDOWKDWZLOOEHWWHUGHÀQHVKRUW
DQGORQJWHUPEHQHÀWV
Philip Schauer, MD, Director of the Cleveland Clinic Bariatric
and Metabolic Institute, and colleagues have helped pioneer
the procedure and have published initial results showing
VLJQLÀFDQWZHLJKWORVV
“Depending on their preoperative weight, patients can expect
to lose 40 to 70 percent of their excess body weight in the
ÀUVW\HDUDIWHUVXUJHU\$OWKRXJKORQJWHUPVWXGLHVDUHQRW\HW
DYDLODEOHWKLVZHLJKWORVVUHVXOWVLQVLJQLÀFDQWLPSURYHPHQWLQ
diabetes as well as hypertension, obstructive sleep apnea and
hypercholesterolemia in the postoperative period,” he says.
In LGCP, the surgeon makes several incisions (< 1 cm) in the
abdomen as portals for the video camera and instrumentation.
One or more folds are made in the stomach, reducing volume
to approximately 75 percent to enhance satiety and reduce
appetite. No stapling or cutting is involved; the folds are
sutured in place.
800.223.2273, ext. 46568
6WDF\%UHWKDXHU0'LVRQHRI&OHYHODQG&OLQLF·VEDULDWULFVXUJHRQV
For more information about gastric plication, contact
Dr. Schauer at 216.444.4794 or at schauep@ccf.org.
| 11 |
clevelandclinic.org/endonotes
Study Compares Glucagon Stimulation Test
to Insulin Tolerance Test in Evaluating Adult
*URZWK+RUPRQH'HÀFLHQF\
With current availability of GHRH limited to research use only, there is no satisfactory
DOWHUQDWLYHWRWKHLQVXOLQWROHUDQFHWHVW,77IRUHYDOXDWLRQRIJURZWKKRUPRQHGHÀFLHQF\
(GHD) in adults. The glucagon stimulation test (GST) has been recommended as
an alternative. Cleveland Clinic is one of four institutions participating in a study
comparing the GST to the ITT for this purpose.
“Our hypothesis is that the GST can accurately and safely diagnose GHD in patients with hypothalamicpituitary disorders. It is readily available, relatively inexpensive and well-tolerated,” says Cleveland Clinic
endocrinologist Amir Hamrahian, MD. “Unlike the ITT, it is not labor-intensive, and there are few contraindications to its use. This is particularly important for clinical endocrinologists who are not comfortable
ZLWKWKH,77RUGRQRWKDYHWKHQHFHVVDU\VWDIIRUORJLVWLFDOVXSSRUWWRFRQGXFW,77VLQWKHLURIÀFHµ
7KUHHVWXG\DUPV
,QRUGHUWRGHWHUPLQHWKHFXWRIISRLQWZLWKWKHKLJKHVWVHQVLWLYLW\DQGVSHFLÀFLW\WRGLIIHUHQWLDWH
between GHD and normal growth hormone levels, the study has been designed with one ITT and
two glucagon arms. One glucagon arm evaluates the standard GST; the other evaluates glucagon
dosage based on weight.
The GST may also be used to evaluate the integrity of the hypothalamic-pituitary-adrenal axis by
provoking ACTH and cortisol secretion. “Cortisol release in response to glucagon seems to be ACTHdependent. Similar to the ITT, the GST examines the entire HPA axis. Whether the test can accurately
evaluate the integrity of the hypothalamic-pituitary-adrenal axis and use the same cutoff values for
cortisol as the ITT and ACTH stimulation tests is unknown,” says Dr. Hamrahian.
It is normal to give 1 or 1.5 mg glucagon if the patient’s weight is greater than 90 kg. In this study,
participants are given 0.03 mg/kg, up to a maximum of 3 mg, to determine whether increasing the dose
improves the ability of the test to use the same cutoff values as the ITT and ACTH stimulation tests.
“This would assure us that the GST will provide results closer to the current gold standard,” he explains.
5HFUXLWPHQWRQJRLQJ
The study is recruiting 30 patients with adult-onset hypothalamic-pituitary disorders: 15 with one
SLWXLWDU\KRUPRQHGHÀFLHQF\3+'RWKHUWKDQ*+'DQGZLWKWZRRUPRUH3+'V7ZHQW\KHDOWK\
controls matched for age, sex and body mass index are also being recruited. The ITT and two GSTs
ZLOOEHGRQHDWLQWHUYDOVRIÀYHWRGD\V'XULQJWKH*67EORRGJOXFRVHFRUWLVRODQGVHUXP*+
levels will be measured at baseline and every 30 minutes, up to 240 minutes.
Endocrine Notes
| 12 |
2011
“Our hypothesis is that the GST can accurately and safely
GLDJQRVHJURZWKKRUPRQHGHÀFLHQF\LQSDWLHQWVZLWKK\SRthalamic-pituitary disorders...Whether the test can accurately
evaluate the integrity of the hypothalamic-pituitary-adrenal
axis and use the same cutoff values for cortisol as the ITT
and ACTH stimulation tests is unknown.”
Other centers participating in this study are Massachusetts General Hospital, the University of
Oregon and Allegheny Hospital.
All patients will receive a small stipend for travel expenses. To refer candidates to Cleveland Clinic or
to obtain further information about inclusion and exclusion criteria, please contact Dr. Hamrahian at
216.445.8538 or at hamraha@ccf.org.
800.223.2273, ext. 46568
| 13 |
clevelandclinic.org/endonotes
Publications
Below are peer-reviewed journal articles and
Abdelmalak B, Zimmerman R, Foss J. Reply [Diagnosing preop-
book chapters published within the past year by
erative hyperglycemia in non-diabetic patients: a challenge and
Endocrinology & Metabolism Institute staff.
an opportunity]. Can J Anaesth.2011;58(6):583.
&OHYH&OLQ-0HG
Journals
Albashir S, Olansky L, Sasidhar M. Progressive muscle
$P-&OLQ1XWU
2011 Jun;78(6):385-391.
weakness: More there than meets the eye. Cleve Clin J Med.
Solomon TPJ, Haus JM, Kelly KR, Cook MD, Filion J, Rocco
Hamaty M. Insulin treatment for type 2 diabetes:
M, Kashyap SR, Watanabe RM, Barkoukis H, Kirwan JP. A
When to start, which to use. Cleve Clin J Med. 2011
low-glycemic index diet combined with exercise reduces insulin
May;78(5):332-342.
resistance, postprandial hyperinsulinemia, and glucose-dependent insulinotropic polypeptide responses in obese, prediabetic
Kashyap SR. In reply [Bariatric surgery, vitamin C, and
humans. Am J Clin Nutr. 2010 Dec;92(6):1359-1368.
kidney stones]. Cleve Clin J Med. 2010 Dec;77(12):844.
$P-7UDQVSODQW
Olansky L. Q: Do incretin drugs for type 2 diabetes increase
the risk of acute pancreatitis? Cleve Clin J Med. 2010
Flechner SM, Berber E, Askar M, Stephany B, Agarwal A, Milas
Aug;77(8):503-505.
M. Allotransplantation of cryopreserved parathyroid tissue
for severe hypocalcemia in a renal transplant recipient. Am J
Pantalone KM, Nasr C. Approach to a low TSH level: Patience is
Transplant. 2010 Sep;10(9):2061-2065.
a virtue. Cleve Clin J Med. 2010 Nov;77(11):803-811.
$QQ,QWHUQ0HG
'LDEHWHV
Shewmon DA, Craig JM. Creatine supplementation prevents
Bhatwadekar AD, Guerin EP, Jarajapu YPR, Caballero S,
statin-induced muscle toxicity. Ann Intern Med. 2010
Sheridan C, Kent D, Kennedy L, Lansang MC, Ruscetti FW,
Nov 16;153(10):690-692.
Pepine CJ, Higgins PJ, Bartelmez SH, Grant MB. Transient
inhibition of transforming growth factor-beta 1 in human diabetic
$QQ6XUJ
CD34+ cells enhances vascular reparative functions. Diabetes.
Jarrar AM, Milas M, Mitchell J, LaGuardia L, O’Malley M,
2010 Aug;59(8):2010-2019.
Berber E, Siperstein A, Burke C, Church JM. Screening for thyroid cancer in patients with familial adenomatous polyposis.
'LDEHWHV&DUH
Ann Surg. 2011 Mar;253(3):515-521.
Pop-Busui R, Evans GW, Gerstein HC, Fonseca V, Fleg JL,
Hoogwerf BJ, Genuth S, Grimm RH, Corson MA, Prineas R.
Milas M, Shin J, Gupta M, Novosel T, Nasr C, Brainard J,
Effects of cardiac autonomic dysfunction on mortality risk in the
Mitchell J, Berber E, Siperstein A. Circulating thyrotropin
Action to Control Cardiovascular Risk in Diabetes (ACCORD) trial.
receptor mRNA as a novel marker of thyroid cancer: clinical
Diabetes Care. 2010 Jul;33(7):1578-1584.
applications learned from 1758 samples. Ann Surg. 2010
Oct;252(4):643-651.
Solomon TPJ, Haus JM, Kelly KR, Rocco M, Kashyap SR,
Kirwan JP. Improved pancreatic beta-cell function in type 2
&DQ-$QDHVWK
diabetic patients after lifestyle-induced weight loss is related to
Abdelmalak B, Abdelmalak JB, Knittel J, Christiansen E, Mascha
glucose-dependent insulinotropic polypeptide. Diabetes Care.
E, Zimmerman R, Argalious M, Foss J. The prevalence of undiag-
2010 Jul;33(7):1561-1566.
nosed diabetes in non-cardiac surgery patients, an observational
study. Can J Anaesth. 2010 Dec;57(12):1058-1064.
Endocrine Notes
| 14 |
2011
'LDEHWHV2EHV0HWDE
-$P&ROO6XUJ
Reasner C, Olansky L, Seck TL, Williams-Herman DE, Chen M,
Attaluri V, Lebeis C, Brethauer S, Rosenblatt S. Advanced lapa-
Terranella L, Johnson-Levonas AO, Kaufman KD, Goldstein BJ.
URVFRSLFWHFKQLTXHVVLJQLÀFDQWO\LPSURYHIXQFWLRQRISHULWRQHDO
7KHHIIHFWRILQLWLDOWKHUDS\ZLWKWKHÀ[HGGRVHFRPELQDWLRQRI
dialysis catheters. J Am Coll Surg. 2010 Dec;211(6):699-704.
sitagliptin and metformin compared with metformin monotherapy
in patients with type 2 diabetes mellitus. Diabetes Obes Metab.
-&OLQ(QGRFULQRO0HWDE
2011 Jul;13(7):644-652.
Tritos NA, Greenspan SL, King D, Hamrahian A, Cook DM,
Jonsson PJ, Wajnrajch MP, Koltowska-Haggstrom M, Biller BMK.
Rhoads GG, Dain MP, Zhang Q, Kennedy L. Two-year
8QUHSODFHGVH[VWHURLGGHÀFLHQF\FRUWLFRWURSLQGHÀFLHQF\DQG
glycaemic control and healthcare expenditures following
lower IGF-I are associated with lower bone mineral density in
initiation of insulin glargine versus neutral protamine Hagedorn
DGXOWVZLWKJURZWKKRUPRQHGHÀFLHQF\$.,06GDWDEDVHDQDO\-
insulin in type 2 diabetes. Diabetes Obes Metab. 2011
sis. J Clin Endocrinol Metab. 2011 May;96(5):1516-1523.
Aug;13(8):711-717.
Zerikly RK, Amiri L, Faiman C, Gupta M, Singh RJ, Nutter B,
(QGRFU3UDFW
Kennedy L, Hatipoglu B, Weil RJ, Hamrahian AH. Diagnostic
Cheng V, Doshi KB, Falcone T, Faiman C. Hyperandrogenism in
characteristics of late-night salivary cortisol using liquid chroma-
a postmenopausal woman: diagnostic and therapeutic challenges.
tography-tandem mass spectrometry. J Clin Endocrinol Metab.
Endocr Pract. 2011 Mar;17(2):e21-e25.
2010 Oct;95(10):4555-4559.
Mulligan GB, Eray E, Faiman C, Gupta M, Pineyro MM, Makdissi
-(QGRXURO
A, Suh JH, Masaryk TJ, Prayson R, Weil RJ, Hamrahian AH.
Reduction of false-negative results in inferior petrosal sinus sampling with simultaneous prolactin and corticotropin measurement.
Endocr Pract. 2011 Jan-Feb;17(1):33-40.
Berber E, Siperstein A. Re: Robot-assisted posterior retroperitoneoscopic adrenalectomy (From: Ludwig AT, Wagner KR, Lowry
PS, et al. J Endourol 2010;24:1307-1314). J Endourol. 2011
Mar;25(3):541-542.
Nyalakonda K, Sharma T, Ismail-Beigi F. Preservation of
Beta-cell function in type 2 diabetes. Endocr Pract. 2010
-+HSDWRO
Nov-Dec;16(6):1038-1055.
Tamimi TI, Elgouhari HM, Alkhouri N, Yerian LM, Berk MP,
Lopez R, Schauer PR, Zein NN, Feldstein AE. An apoptosis
Pantalone KM, Faiman C, Olansky L. Insulin glargine use during
panel for nonalcoholic steatohepatitis diagnosis. J Hepatol. 2011
pregnancy. Endocr Pract. 2011 May;17(3):448-455.
Jun;54(6):1224-1229.
([SHUW5HY(QGRFULQRO0HWDE
-/RQJ7HUP(II0HG,PSODQWV
Hatipoglu BA, Kennedy L. Postradiation therapy hypopituitarism.
El-Hayek KM, Chand B. Biologic prosthetic materials for hernia
Expert Rev Endocrinol Metab. 2011 Mar;6(2):187-194.
repairs. J Long Term Eff Med Implants. 2010;20(2):159-169.
*DVWURLQWHVW(QGRVF&OLQ1$P
0HWDE6\QGU5HODW'LVRUG
Tariq N, Chand B. Presurgical evaluation and postoperative care
Kashyap SR, Roman LJ, Mandarino L, DeFronzo R, Bajaj M.
for the bariatric patient. Gastrointest Endosc Clin N Am. 2011
Hypoadiponectinemia is closely associated with impaired nitric
Apr;21(2):229-240.
oxide synthase activity in skeletal muscle of type 2 diabetic
subjects. Metab Syndr Relat Disord. 2010 Oct;8(5):459-463.
+3%2[IRUG
Berber E, Akyildiz HY, Aucejo F, Gunasekaran G, Chalikonda S,
0LQHUYD(QGRFULQRO
Fung J. Robotic versus laparoscopic resection of liver tumours.
Milas Z, Shin J, Milas M. New guidelines for the management
HPB (Oxford). 2010 Oct;12(8):583-586.
of thyroid nodules and differentiated thyroid cancer. Minerva
Endocrinol. 2011 Mar;36(1):53-70.
,QW-(QGRFULQRO
Yusupov E, Li-Ng M, Pollack S, Yeh JK, Mikhail M, Aloia JF.
Vitamin D and serum cytokines in a randomized clinical trial.
Int J Endocrinol. 2010;2010:305054.
continued on next page
800.223.2273, ext. 46568
| 15 |
clevelandclinic.org/endonotes
Publications
continued
1DWXUH
Wang Z, Klipfell E, Bennett BJ, Koeth R, Levison BS, Dugar B,
Ransom D, Ashton K, Windover A, Heinberg L. Internal consis-
Feldstein AE, Britt EB, Fu X, Chung YM, Wu Y, Schauer P, Smith
tency and validity assessment of SCL-90-R for bariatric surgery
JD, Allayee H, Tang WHW, DiDonato JA, Lusis AJ, Hazen SL.
candidates. Surg Obes Relat Dis. 2010 Nov-Dec;6(6):622-627.
*XWÁRUDPHWDEROLVPRISKRVSKDWLG\OFKROLQHSURPRWHVFDUGLRYDVcular disease. Nature. 2011 Apr 7;472(7341):57-63.
psychosocial correlates of self-reported past suicide attempts
among bariatric surgery candidates. Surg Obes Relat Dis. 2010
3LWXLWDU\
Nov-Dec;6(6):702-706.
Marko NF, Hamrahian AH, Weil RJ. Immediate postoperative
cortisol levels accurately predict postoperative hypothalamic-
6XUJHU\
pituitary-adrenal axis function after transsphenoidal surgery for
Akyildiz HY, Mitchell J, Milas M, Siperstein A, Berber E.
pituitary tumors. Pituitary. 2010 Sep;13(3):249-255.
Laparoscopic radiofrequency thermal ablation of neuroendocrine hepatic metastases: Long-term follow-up. Surgery. 2010
6XUJ(QGRVF
Dec;148(6):1288-1293.
Akyildiz HY, Morris-Stiff G, Aucejo F, Fung J, Berber E. Techniques
of radiofrequency-assisted precoagulation in laparoscopic liver
7K\URLG
resection. Surg Endosc. 2011 Apr;25(4):1143-1147.
Greenlee C, Burmeister LA, Butler RS, Edinboro CH, Morrison
SM, Milas M. Current safety practices relating to I-131 admin-
6XUJ/DSDURVF(QGRVF3HUFXWDQ7HFK
istration for diseases of the thyroid: a survey of physicians and
Alasfar F, Chand B. Intraoperative endoscopy for laparoscopic
allied practitioners. Thyroid. 2011 Feb;21(2):151-160.
Roux-en-Y gastric bypass: leak test and beyond. Surg Laparosc
Endosc Percutan Tech. 2010 Dec;20(6):424-427.
Shin J, Chute D, Milas M, Mitchell J, Siperstein A, Berber E. A
rare case of chronic lymphocytic leukemia/small lymphocytic
Harvey A, Bohacek L, Neumann D, Mihaljevic T, Berber E.
lymphoma presenting in the thyroid gland. Thyroid. 2010
Robotic thoracoscopic mediastinal parathyroidectomy for persistent hyperparathyroidism: case report and review of the literature.
Surg Laparosc Endosc Percutan Tech. 2011 Feb;21(1):e24-e27.
Mitchell J, Siperstein A, Milas M, Berber E. Laparoscopic
resection of abdominal paragangliomas. Surg Laparosc Endosc
Percutan Tech. 2011 Feb;21(1):e48-e53.
6XUJ2EHV5HODW'LV
Ashton K, Heinberg L, Windover A, Merrell J. Positive response
to binge eating intervention enhances postoperative weight loss.
Surg Obes Relat Dis. 2011 May-Jun;7(3):315-320.
Windover AK, Merrell J, Ashton K, Heinberg LJ. Prevalence and
Sep;20(9):1019-1023.
Sisson TA, Freitas J, McDougall IR, Dauer LT, Hurley JR, Brierley
JD, Edinboro CH, Rosenthal D, Thomas MJ, Wexler JA, Asamoah
E, Avram AM, Milas M, Greenlee C. Radiation safety in the
treatment of patients with thyroid diseases by radioiodine (131)i:
practice recommendations of the American Thyroid Association.
Thyroid. 2011 Apr;21(4):335-346.
8OXVDO&HUUDKL'HUJLVL
Karabulut K, Berber E. Robotik endokrin cerrahi [Robotic endocrine surgery] [Turkish]. Ulusal Cerrahi Dergisi. 2011;27(1):1-5.
Brethauer SA, Chand B, Schauer PR, Thompson CC. Transoral
gastric volume reduction for weight management: technique
Nov-Dec;6(6):689-694.
Book Chapters
Brethauer SA, Harris JL, Kroh M, Schauer PR. Laparoscopic
Ashton K, Budur K. Scared to sleep: A Hurricane Katrina survi-
and feasibility in 18 patients. Surg Obes Relat Dis. 2010
gastric plication for treatment of severe obesity. Surg Obes
vor. In: Foldvary-Schaefer N, Krishna J, Budur K, eds. A Case a
Relat Dis. 2011 Jan-Feb;7(1):15-22.
Week: Sleep Disorders From the Cleveland Clinic. Oxford; New
Gatmaitan P, Huang H, Talarico J, Moustarah F, Kashyap S,
Kirwan JP, Schauer PR, Brethauer SA. Pancreatic islet isolation
York, NY: Oxford University Press; 2011. Chapter 3. p. 43-48.
Ashton K, Streem D. Smoking cessation. In: Carey WD, ed.
after gastric bypass in a rat model: technique and initial results
Current Clinical Medicine. 2nd ed. Philadelphia, PA: Saunders/
for a promising research tool. Surg Obes Relat Dis. 2010
Elsevier; 2010. p. 977-980.
Sep-Oct;6(5):532-537.
Endocrine Notes
| 16 |
2011
Babar T, Skugor M. Diabetes mellitus treatment. In: Carey
Mitchell JC. Clinical detection and treatment of pancreatic
WD, ed. Current Clinical Medicine. 2nd ed. Philadelphia, PA:
neuroendocrine tumors. In: Hunt JL, ed. Molecular Pathology of
Saunders/Elsevier; 2010. p. 358-363.
Endocrine Diseases. New York, NY: Springer; 2010. Chapter 22.
p. 229-235.
Brethauer S, Kashyap S, Schauer P. Obesity. In: Carey WD, ed.
Mitchell JC, Milas M. Clinical detection and treatment of thyroid
Current Clinical Medicine. 2nd ed. Philadelphia, PA: Saunders/
diseases. In: Hunt JL, ed. Molecular Pathology of Endocrine
Elsevier; 2010. p. 391-396.
Diseases. New York, NY: Springer; 2010. Chapter 4. p. 27-35.
Chikunguwo SM, Brethauer SA, Schauer PR. Bariatric surgery.
Moustarah F, Brethauer SA, Schauer PR. Laparoscopic surgery
In: Cameron JL, Cameron AM, eds. Surgery of the Esophagus
and Stomach. London; New York, NY: Springer; 2011. Chapter
for severe obesity. In: Cameron JL, Cameron AM, eds. Current
16. p. 217-232.
Surgical Therapy. 10th ed. Philadelphia, PA: Saunders/Elsevier;
2011. p. 1304-1316.
Chinnappa P, Mehta A. Hirsutism. In: Carey WD, ed. Current
Clinical Medicine. 2nd ed. Philadelphia, PA: Saunders/Elsevier;
Nasr C. Flushing. In: Carey WD, ed. Current Clinical Medicine.
2010. p. 376-379.
2nd ed. Philadelphia, PA: Saunders/Elsevier; 2010. p. 369-375.
Diab DL, Hamrahian AH. Clinical detection and treatment of be-
Reddy SSK. Hypothalamic-pituitary disorders. In: Camacho PM,
nign and malignant pituitary diseases. In: Hunt JL, ed. Molecular
ed. A Color Handbook of Clinical Endocrinology and Metabolism.
Pathology of Endocrine Diseases. New York, NY: Springer; 2010.
London: Manson Pub.; 2011. Chapter 4. p. 91-112.
Chapter 17. p. 169-174.
Schirmer B, Schauer PR. The surgical management of obesity.
Faiman C. Male hypogonadism. In: Carey WD, ed. Current
In: Brunicardi FC, ed. Schwartz’s Principles of Surgery. 9th ed.
Clinical Medicine. 2nd ed. Philadelphia, PA: Saunders/Elsevier;
New York, NY: McGraw-Hill; 2010. Chapter 27. p. 949-978.
2010. p. 397-401.
Skugor M. Section 4: Endocrinology [Section editor]. In: Carey
Gatmaitan P, Brethauer SA, Schauer PR. Obesity and presenta-
WD, ed. Current Clinical Medicine. 2nd ed. Philadelphia, PA:
tions after anti-obesity surgery. In: Talley NJ, Kane SV, Wallace
Saunders/Elsevier; 2010. p. 335-420.
MB, eds. Practical Gastroenterology and Hepatology. Small
Skugor M. Hypocalcemia and hypercalcemia. In: Carey WD, ed.
and Large Intestine and Pancreas. Chichester, West Sussex ;
Current Clinical Medicine. 2nd ed. Philadelphia, PA: Saunders/
Hoboken, NJ: Wiley-Blackwell; 2010. Chapter 24. p. 169-175.
Elsevier; 2010. p. 380-386.
Gopan T, Hamrahian A. Adrenal disorders. In: Camacho PM, ed.
A Color Handbook of Clinical Endocrinology and Metabolism.
Skugor M. Osteoporosis. In: Carey WD, ed. Current Clinical
Medicine. 2nd ed. Philadelphia, PA: Saunders/Elsevier; 2010.
London: Manson Pub.; 2011. Chapter 5. p. 113-147.
p. 402-407.
Harvey AM, Siperstein AE, Berber E. Clinical detection and
Skugor M, Fleseriu M. Hypothyroidism and hyperthyroidism. In:
treatment of adrenal disease. In: Hunt JL, ed. Molecular
Pathology of Endocrine Diseases. New York, NY: Springer; 2010.
Carey WD, ed. Current Clinical Medicine. 2nd ed. Philadelphia,
Chapter 19. p. 197-203.
PA: Saunders/Elsevier; 2010. p. 416-420.
Hoogwerf BJ. Diabetes mellitus: Disease management. In: Carey
Skugor M, Hamrahian AH. Pituitary disorders. In: Carey WD, ed.
WD, ed. Current Clinical Medicine. 2nd ed. Philadelphia, PA:
Current Clinical Medicine. 2nd ed. Philadelphia, PA: Saunders/
Saunders/Elsevier; 2010. p. 350-354.
Elsevier; 2010. p. 408-415.
Ioachimescu AG, Hamrahian AH. Diseases of the adrenal
Zimmerman R. Microvascular complications of diabetes. In:
gland. In: Carey WD, ed. Current Clinical Medicine. 2nd ed.
Philadelphia, PA: Saunders/Elsevier; 2010. p. 336-349.
800.223.2273, ext. 46568
Carey WD, ed. Current Clinical Medicine. 2nd ed. Philadelphia,
PA: Saunders/Elsevier; 2010. p. 355-357.
| 17 |
clevelandclinic.org/endonotes
Live and Online
CME Opportunities
&OHYHODQG&OLQLF·V&HQWHUIRU&RQWLQXLQJ(GXFDWLRQRIIHUV
FRQYHQLHQWFRPSOLPHQWDU\OHDUQLQJRSSRUWXQLWLHVIURP
ZHEFDVWVDQGSRGFDVWVWRDKRVWRIPHGLFDOSXEOLFDWLRQV
LQDGGLWLRQWROLYH&0(V\PSRVLD
The 9th Annual Dr. Roizen’s Preventive Care
and Integrative Medicine Conference
Focus: Reversing Metabolic and Endocrine Disorders, including
Metabolic Syndrome, Type 2 Diabetes and Thyroid Disorders,
and Increasing Sexual Enjoyment
December 9-11, 2011
0LUDJH+RWHODQG5HVRUW/DV9HJDV1HY
This activity has been approved for AMA PRA Category 1 Credits.™
To register, please call 216.448.0777, email cmeregistration@ccf.org
or visit www.ccfcme.org/wellness11.
2QOLQH&0(
Online webcasts of interest to endocrinologists and approved for AMA PRA Category 1 Credits™ include:
“Can We Develop a Viable PPAR
Agonist for Diabetic Patients?”
and “Challenges in Developing
New Therapies for Risk Reduction
in Diabetes”
5HOHDVH'DWH)HE
(VWLPDWHG7LPHPLQXWHV
´,QWHQVLYH/LSLG0RGLÀFDWLRQLQWKH
Diabetic Patient and Plaque Progression
in Diabetic Patients: Insights from
Arterial Wall Imaging”
5HOHDVH'DWH)HE
(VWLPDWHG7LPHPLQXWHV
“New and Novel Therapies for
Low Bone Mass”
5HOHDVH'DWH-DQ
(VWLPDWHG7LPHPLQXWHV
“Robotic Endocrine Surgery”
5HOHDVH'DWH$SU
(VWLPDWHG7LPHPLQXWHV
For a full list of all Cleveland Clinic CME opportunities, please visit FFIFPHRUJ; to manage your CME credits,
use the P\&0(FRP Web portal, available 24/7.
Endocrine Notes
| 18 |
2011
Current Clinical Trials
TITLE
PI
CO N TA C T / N U M B E R
International Metabolic Study (KIMS®)
$PLU+DPUDKLDQ0'
Melanie Williams
216.444.5410
A Proof of Concept, Open-Label, Forced Titration, Multicenter Study to Assess the Safety/Tolerability and
(IÀFDF\RID:HHN7UHDWPHQWRI/&,LQ3DWLHQWVZLWK&XVKLQJ·V'LVHDVH
$PLU+DPUDKLDQ0'
Melanie Williams
216.444.5410
A Blinded, Placebo-Controlled, Single Ascending Dose, Phase 1 Trial for Safety, Tolerability,
Pharmacokinetics and Pharmacodynamics after Subcutaneous Administration of VRS-317 in Adults
ZLWK*URZWK+RUPRQH'HÀFLHQF\
$PLU+DPUDKLDQ0'
Melanie Williams
216.444.5410
A Phase III, Multinational, Randomized, Double-Blind, Placebo-Controlled Parallel-Group Study
WR,QYHVWLJDWHWKH&OLQLFDO(IÀFDF\DQG6DIHW\RI'LD3HS5LQ1HZO\'LDJQRVHG7\SH'LDEHWHV6XEMHFWV
/HDQQ2ODQVN\0'
Melanie Williams
216.444.5410
A Randomized, Double-Masked, Placebo-Controlled, Multicenter, Phase 2 Study to Evaluate the Safety and
5HQDO(IÀFDF\RI/<LQ3DWLHQWVZLWK'LDEHWLF.LGQH\'LVHDVH'XHWR7\SHRU7\SH'LDEHWHV
/HDQQ2ODQVN\0'
Melanie Williams
216.444.5410
TECOS: A Randomized, Placebo-Controlled Clinical Trial to Evaluate Cardiovascular Outcomes after
Treatment with Sitagliptin in Patients with Type 2 Diabetes Mellitus and Inadequate Glycemic Control
on Mono- or Dual-Combination Oral Antihyperglycemic Therapy
5REHUW=LPPHUPDQ0'
Melanie Williams
216.444.5410
The Global Hypopituitary Control and Complications Study (HypoCCS)
$PLU+DPUDKLDQ0'
Melanie Williams
216.444.5410
The Diagnostic Accuracy of the Glucagon Stimulation Test for Evaluation of Adult Growth Hormone
'HÀFLHQF\DQG+\SRWKDODPLF3LWXLWDU\$GUHQDO$[LV
$PLU+DPUDKLDQ0'
Melanie Williams
216.444.5410
ACROSTUDY - A Multicenter, Post-Marketing Surveillance Study of Somavert Therapy in Patients with
Acromegaly in the USA and Europe
$PLU+DPUDKLDQ0'
Melanie Williams
216.444.5410
Pelvic Floor Disorders in Bariatric Surgery Patients
6WDF\%UHWKDXHU0'
Sharon O’Keefe
216.445.8461
A Prospective, Randomized, Controlled Trial Comparing Advanced Practice Medical Management vs. Advanced Practice Medical Management Plus Bariatric Surgery in The Treatment of Type 2 Diabetes Mellitus
3KLOLS6KDXHU0'
Chytaine Hall
216.445.3983
Prospective Randomized Comparison of Bilateral vs. Focal Neck Exploration for Sporadic Hyperparathyroidism
$OODQ6LSHUVWHLQ0'
Linda Heil
216.444.2262
(IIHFWRI3DUDWK\URLGHFWRP\LQ5HGXFLQJ&RURQDU\$UWHU\&DOFLÀFDWLRQDQG,PSURYLQJ9DVFXODU&RPSOLDQFH
in Patients with Primary and Secondary Hyperparathyroidism
(UHQ%HUEHU0'
Linda Heil
216.444.2262
T1D Exchange Type 1 Diabetes Network
/DXUHQFH.HQQHG\0'
Denise Rose
216.444.8824
Gastric Plication for the Treatment of Obesity and Related Conditions
3KLOLS6FKDXHU0'
Sharon O’Keefe,
216.445.8461
Effect of a Portion-Controlled, Commercially Available Diet on Pre-Surgical Weight Loss and
Metabolic Outcomes in Patients Undergoing Laparoscopic Bariatric Surgery
/HVOLH+HLQEHUJ0'
Sharon O’Keefe,
216.445.8461
Is Nipple Stimulation by a Piercing Capable of Increasing Serum Prolactin Concentrations?
%HWXO+DWLSRJOX0'
Melanie Williams,
216.444.5410
ACCORDION: Action to Control Cardiovascular Risk in Diabetes Trial
/HDQQ2ODQVNL0'
Melanie Williams,
216.444.5410
Exenatide Study of Cardiovascular Event Lowering (EXSCEL)
5REHUW=LPPHUPDQ0'
Melanie Williams,
216.444.5410
800.223.2273, ext. 46568
| 19 |
clevelandclinic.org/endonotes
Endocrinology & Metabolism Institute
Staff Directory
ENDOCRINOLOGY & METABLOLISM INSTITUTE LEADERSHIP
James Young, MD
Institute Chairman
Endocrinology & Metabolism Institute
216.444.2333
Allan Siperstein, MD
Chairman, Department of Endocrine
Surgery
Laurence (Ned) Kennedy, MD
Chairman, Department of Endocrinology,
Diabetes and Metabolism
Philip Schauer, MD
Chairman, Bariatric and Metabolic
Institute
216.445.8645
216.444.4794
216.444.5664
Department of Endocrinology, Diabetes and Metabolism
Sanjit Bindra, MD
Specialty Interest(s): General endocrinology, diabetes
Location(s): Lakewood Hospital Professional Building
Office: 216.529.5300 | Fax: 216.529.5301
Appointments: 216.529.5300
Amir Hamrahian, MD
Specialty Interest(s): Pituitary and adrenal disorders
Location(s): Main campus
Office: 216.445.8538 | Fax: 216.445.1656
Appointments: 216.444.6568
Kevin Borst, DO
Specialty Interest(s): Endocrine disorders
in pregnancy, general endocrinology, diabetes
Location(s): Lakewood Hospital Professional Building
Office: 216.529.5300 | Fax: 216.529.5301
Appointments: 216.529.5300
Betul Hatipoglu, MD
Specialty Interest(s): Diabetes, thyroid
disorders, pituitary disorders, adrenal disorders,
alternative medicine
Location(s): Main campus
Office: 216.445.6709 | Fax: 216.445.1656
Appointments: 216.444.6568
Krupa Doshi, MD
Specialty Interest(s): General endocrinology, diabetes,
parathyroid and calcium disorders, hirsutism, thyroid
disorders, adrenal disorders, osteoporosis
Location(s): Main campus
Office: 216.445.0741 | Fax: 216.445.1656
Appointments: 216.444.6568
Revital Gorodeski Baskin, MD
Specialty Interest(s): Endocrinology,
thyroid disorders, thyroid cancer
Location(s): Independence Family Health Center
Office: 216.986.4000 | Fax: 216.986.4995
Appointments: 216.986.4000
Marwan Hamaty, MD
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus; Strongsville Family Health
and Surgery Center
Office: 216.445.7568 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Strongsville, 440.878.2500
Visit clevelandclinic.org/EndoStaff for the most current staff listings and locations.
Suman Jana, MD
Specialty Interest(s): General endocrinology,
diabetes, thyroid disease, thyroid cancer
Location(s): Main campus; Medina
Office: 216.444.0567 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Medina, 330.725.3713
Sangeeta Kashyap, MD
Specialty Interest(s): Endocrinology, diabetes,
metabolism, insulin resistance and cardiovascular
risk prevention, obesity, metabolic syndrome and
diseases, hyperlipidemia
Location(s): Main campus
Office: 216.445.2679 | Fax: 216.445.1656
Appointments: 216.444.6568
Laurence (Ned) Kennedy, MD
Department Chair
Specialty Interest(s): General endocrinology,
diabetes, pituitary disorders, hyperthyroidism,
hypothyroidism, thyroiditis
Location(s): Main campus; Ashtabula County
Medical Center; Cleveland Clinic Florida, Weston
Office: 216.445.8645 | Fax: 216.445.1656
Appointments: Main Campus, 216.444.6568;
Ashtabula, 440.997.6910; Florida, 954.659.6038
Endocrinology & Metabolism Institute | Staff Directory
Contact Us
General Patient Referral
24/7 hospital transfers or physician
consults – 800.553.5056
Endocrinology & Metabolism Institute
Appointments/Referrals
216.444.6568 or 800.223.2273,
ext. 46568
Bariatric Surgery
Appointments/Referrals
216.445.2224 or 800.223.2273,
ext. 52224
On the Web at
clevelandclinic.org/endonotes
Endocrinology &
Metabolic Institute
Locations
Main Campus
9500 Euclid Ave./F20
Cleveland, Ohio 44195
216.444.6568
Endocrinology & Metabolic
Institute Diabetes Center
10685 Carnegie Ave.
Cleveland, Ohio 44106
216.444.6568
Ashtabula County Medical Center
2420 Lake Ave.
Cleveland, Ohio 44404
440.997.6969
Cleveland Clinic Beachwood
Family Health and Surgery Center
26900 Cedar Road
Beachwood, Ohio 44122
216.839.3000
Cleveland Clinic Independence
Family Health Center
5001 Rockside Road
Crown Center II
Independence, Ohio 44131
216.986.4000
Cleveland Clinic Lorain
Family Health and Surgery Center
5700 Cooper Foster Park Road
Lorain, Ohio 44053
440.204.7400
Cleveland Clinic Solon
Family Heath Center
29800 Bainbridge Road
Solon, Ohio 44139
440.519.6800
Cleveland Clinic Willoughby
Hills Family Health Center
2570 SOM Center Road
Willoughby Hills, Ohio 44094
440.943.2500
Cleveland Clinic Wooster
Family Health Center
1740 Cleveland Road
Wooster, Ohio 44691
330.287.4500
Lakewood Hospital
Professional Building
14601 Detroit Road
Lakewood, Ohio 44107
216.529.5300
Medina Hospital
Professional Building
4087 Medina Road, Ste. 400
Medina, Ohio 44256
330.725.3713
Cleveland Clinic Stephanie
Tubbs Jones Health Center
13944 Euclid Ave.
East Cleveland, Ohio 44112
216.767.4242
Cleveland Clinic Strongsville Family
Health and Surgery Center
16761 SouthPark Center
Strongsville, Ohio 44136
440.878.2500
Cleveland Clinic Twinsburg Family
Health and Surgery Center
8701 Darrow Road
Twinsburg, Ohio 44087
330.888.4000
South Pointe Charles Miner
Medical Building
20600 Harvard Road
Warrensville Heights, Ohio 44122
216.295.1010
Cleveland Clinic Florida
2950 Cleveland Clinic Blvd.
Weston, Fla. 33331
877.463.2010
Endocrine Notes
Chairman, Endocrinology & Metabolism Institute
James B. Young, MD
Endocrine Notes updates physicians on clinical practices, advances and research from Cleveland Clinic’s
Managing Editor
Cora M. Liderbach
Endocrinology & Metabolism Institute. It is written for
Art Director
Mike Viars
purposes only. It does not provide a complete overview of
Marketing
Bill Sattin, PhD
Mary Anne Connor
physicians and should be relied upon for medical education
the topics covered and should not replace the independent
judgment of a physician about the appropriateness or risks
of a procedure for a given patient.
© 2011 The Cleveland Clinic Foundation
Leila Khan, MD
Specialty Interest(s): General endocrinology,
diabetes, calcium/bone disorders
Location(s): Main campus; Willoughby Hills
Family Health Center
Office: 216.445.1598 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Willoughby Hills, 440.943.2500
Leann Olansky, MD
Specialty Interest(s): Diabetes and diabetes complications, gestational diabetes, general endocrinology
Location(s): Main campus; Stephanie Tubbs Jones
Health Center
Office: 216.444.2642 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Stephanie Tubbs Jones Health Center, 216.767.4242
M. Cecilia Lansang, MD, MPH
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus
Office: 216.445.5246 | Fax: 216.445.1656
Appointments: 216.444.6568
Richard Shewbridge, MD
Specialty Interest(s): Endocrinology, diabetes, thyroid
disorders, hyperlipidemia, osteoporosis
Location(s): Medina
Office: 330.725.3713 | Fax: 330.725.2141
Appointments: 330.725.3713
Melissa Li-Ng, MD
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus; Solon Family Health Center
Office: 216.444.1949 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Solon, 440.519.6800
Vinni Makin, MD
Specialty Interest(s): General endocrinology,
diabetes, hirsutism, acne, thyroid disorders
Location(s): Main campus; Solon Family Health Center
Office: Main campus, 216.444.0539;
Solon, 440.519.6800 | Fax: Main campus,
216.445.1656; Solon, 440.519.6908
Appointments: Main campus, 216.444.6568;
Solon, 440.519.6800
Adi Mehta, MD
Specialty Interest(s): Diabetes mellitus, thyroid
disorders, gynecologic endocrinology, endocrine
complications of pregnancy, menopause, lipid
disorders, general and adolescent endocrinology
Location(s): Main campus; Beachwood Family
Health Center (Reproductive Endocrinology only)
Office: 216.445.5312 | Fax: 216.445.7261
Appointments: Main campus, 216.444.6568;
Beachwood, 216.839.3000
Guy Mulligan, MD
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus; Twinsburg Family Health
and Surgery Center; South Pointe/Charles Miner
Medical Building
Office: 330.888.4000 | Fax: 330.963.4561
Appointments: Main Campus, 216.444.6568;
Twinsburg, 330.888.4000; South Pointe,
216.295.1010
Mario Skugor, MD
Co-director, Thyroid Center
Associate Director, Endocrinology Fellowship Program
Specialty Interest(s): Osteoporosis and calcium
metabolism, obesity and diabetes, multiple endocrine
neoplasia syndromes, thyroid disorders, thyroid cancer
Location(s): Main campus
Office: 216.445.0739 | Fax: 216.445.1656
Appointments: 216.444.6568
David Shewmon, MD
Specialty Interest(s): General endocrinology, diabetes,
high cholesterol, osteomalacia, osteoporosis, pituitary
tumors, thyroid conditions, thyroid cancer
Location(s): Wooster Family Health Center
Office: 330.287.4690 | Fax: 330.287.4876
Appointments: 330.287.4690
Mariam Stevens, MD
Specialty Interest(s): Diabetes, gestational diabetes,
goiter, Graves’ disease, Hashimoto’s disease, hirsutism,
hyperthyroidism, hypoglycemia, hypothyroidism,
polycystic ovary syndrome, thyroid disease,
thyroid nodule
Location(s): Independence Family Health Center
Office: 216.986.4000 | Fax: 216.986.4995
Appointments: 216.986.4000
Robert Zimmerman, MD
Director, Cleveland Clinic Diabetes Center
Vice Chairman, Department of Endocrinology, Diabetes
and Metabolism
Program Director, Endocrinology Training Program
Specialty Interest(s): Diabetes, thyroid disorders, growth
hormone in adults
Location(s): Main campus
Office: 216.444.9428 | Fax: 216.445.1656
Appointments: 216.444.6568
Department of Endocrine Surgery
Bariatric and Metabolic Institute
Eren Berber, MD
Director, Robotic Endocrine Surgery
Specialty Interest(s): Endocrine surgery (thyroid and
parathyroid), laparoscopic solid-organ surgery, advanced
laparoscopic surgery, laparoscopic radiofrequency
ablation of liver tumors, pancreatic neuroendocrine
tumors, robotic thyroid and parathyroid surgery,
laparoscopic and robotic adrenalectomy and liver surgery
Location(s): Main campus
Office: 216.445.0555 | Fax: 216.636.0662
Appointments: 216.444.6568
Kresimira (Mira) Milas, MD
Director, Thyroid Center
Specialty Interest(s): Endocrine surgery (thyroid
and parathyroid), thyroid cancer, multiple endocrine
neoplasia syndromes, hereditary thyroid disorders
Location(s): Main campus
Office: 216.444.4985 | Fax: 216.636.0662
Appointments: 216.444.6568
Jamie Mitchell, MD
Specialty Interest(s): Endocrine surgery (thyroid,
parathyroid and adrenal), laparoscopic solid organ
surgery, advanced laparoscopic surgery, laparoscopic
radiofrequency ablation of liver tumors
Location(s): Main campus; Independence Family Health
Center; Solon Family Health Center
Office: 216.445.9713 | Fax: 216.636.0662
Appointments: Main campus, 216.444.6568;
Independence, 216.986.4000; Solon, 440.519.6800
Joyce J. Shin, MD
Specialty Interest(s): Endocrine surgery (thyroid and
parathyroid), advanced laparoscopic surgery, laparoscopic
adrenalectomy, neuroendocrine tumors, thyroid/parathyroid
ultrasound, intra-abdominal ultrasound, laparoscopic
radiofrequency thermal ablation of liver tumors
Location(s): Main campus; Willoughby Hills
Family Health Center
Office: 216.636.9365 | Fax: 216.636.0662
Appointments: Main campus, 216.444.6568;
Willoughby Hills, 440.943.2500
Allan Siperstein, MD
Department Chair
Specialty Interest(s): Endocrine surgery (thyroid and
parathyroid), advanced laparoscopic surgery, laparoscopic
adrenalectomy, laparoscopic thermal ablation of liver
tumors, pancreatic endocrine tumors
Location(s): Main campus
Office: 216.444.5664 | Fax: 216.636.0662
Appointments: 216.444.6568
Christian Nasr, MD
Co-director, Thyroid Center
Specialty Interest(s): Thyroid nodules, thyroid
cancers, flushing syndromes
Main campus; Lorain Family Health and Surgery Center
(Thyroid cancer only)
Office: 216.445.1788 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Lorain, 440.204.7400
Stacy Brethauer, MD
Specialty Interest(s): Bariatric surgery, laparoscopic surgery,
gastrointestinal surgery, hernia repair, endoscopy, surgery for
GERD, hiatal hernia, solid-organ endoluminal surgery,
single-incision laparoscopic surgery
Location(s): Main campus
Office: 216.444.9244 | Fax: 216.445.1586
Appointments: 216.445.2224
Derrick Cetin, DO
Specialty Interest(s): Bariatric medicine, medical weight
management, nutrition sciences, obesity management,
preoperative evaluation, diabetes care
Location(s): Main Campus
Office: 216.445.4255 | Fax: 216.636.1588
Appointments: 216.445.2224
Bipan Chand, MD
Specialty Interest(s): Advanced laparoscopy and endoscopy,
endoscopy in the obese patient, gastric surgery focusing on
reflux disease, hiatal hernia, bariatric operations and gastric
cancer, biliary and spleen surgery, natural orifice transluminal
endoscopic surgery (NOTES), endoluminal surgery
Location(s): Main campus
Office: 216.444.6668 | Fax: 216.445.1586
Appointments: 216.445.2224
Karen Cooper, DO
Specialty Interest(s): Bariatric medicine, family medicine,
kinesiology and nutrition sciences, exercise instruction
Location(s): Main campus
Office: 216.445.1114 | Fax: 216.445.1586
Appointments: 216.445.2224
Matthew Kroh, MD
Specialty Interest(s): Advanced laparoscopic surgery,
bariatric surgery, gastrointestinal surgery, endoscopy,
single-incision laparoscopic surgery
Location(s): Main campus
Office: 216.445.9966 | Fax: 216.444.2153
Appointments: 216.445.2224
Tomasz Rogula, MD, PhD
Specialty Interest(s): Advanced laparoscopic surgery,
bariatric surgery, gastrointestinal surgery, endoscopy,
single-incision laparoscopic surgery
Location(s): Main campus; Strongsville Family Health
and Surgery Center
Office: 216.445.0255 | Fax: 216.445.1586
Appointments: Main campus: 216.445.2224;
Strongsville: 440.878.2500
Philip Schauer, MD
Department Chair
Specialty Interest(s): Bariatric surgery, laparoscopic surgery,
gastrointestinal surgery, colon surgery, weight management,
hernia surgery, biliary surgery, surgery for GERD
Location(s): Main campus
Office: 216.444.4794 | Fax: 216.445.1586
Appointments: 216.445.2224
Visit clevelandclinic.org/EndoStaff for the most current staff listings and locations.
Endocrinology & Metabolism Institute | Staff Directory
Contact Us
General Patient Referral
24/7 hospital transfers or physician
consults – 800.553.5056
Endocrinology & Metabolism Institute
Appointments/Referrals
216.444.6568 or 800.223.2273,
ext. 46568
Bariatric Surgery
Appointments/Referrals
216.445.2224 or 800.223.2273,
ext. 52224
On the Web at
clevelandclinic.org/endonotes
Endocrinology &
Metabolic Institute
Locations
Main Campus
9500 Euclid Ave./F20
Cleveland, Ohio 44195
216.444.6568
Endocrinology & Metabolic
Institute Diabetes Center
10685 Carnegie Ave.
Cleveland, Ohio 44106
216.444.6568
Ashtabula County Medical Center
2420 Lake Ave.
Cleveland, Ohio 44404
440.997.6969
Cleveland Clinic Beachwood
Family Health and Surgery Center
26900 Cedar Road
Beachwood, Ohio 44122
216.839.3000
Cleveland Clinic Independence
Family Health Center
5001 Rockside Road
Crown Center II
Independence, Ohio 44131
216.986.4000
Cleveland Clinic Lorain
Family Health and Surgery Center
5700 Cooper Foster Park Road
Lorain, Ohio 44053
440.204.7400
Cleveland Clinic Solon
Family Heath Center
29800 Bainbridge Road
Solon, Ohio 44139
440.519.6800
Cleveland Clinic Willoughby
Hills Family Health Center
2570 SOM Center Road
Willoughby Hills, Ohio 44094
440.943.2500
Cleveland Clinic Wooster
Family Health Center
1740 Cleveland Road
Wooster, Ohio 44691
330.287.4500
Lakewood Hospital
Professional Building
14601 Detroit Road
Lakewood, Ohio 44107
216.529.5300
Medina Hospital
Professional Building
4087 Medina Road, Ste. 400
Medina, Ohio 44256
330.725.3713
Cleveland Clinic Stephanie
Tubbs Jones Health Center
13944 Euclid Ave.
East Cleveland, Ohio 44112
216.767.4242
Cleveland Clinic Strongsville Family
Health and Surgery Center
16761 SouthPark Center
Strongsville, Ohio 44136
440.878.2500
Cleveland Clinic Twinsburg Family
Health and Surgery Center
8701 Darrow Road
Twinsburg, Ohio 44087
330.888.4000
South Pointe Charles Miner
Medical Building
20600 Harvard Road
Warrensville Heights, Ohio 44122
216.295.1010
Cleveland Clinic Florida
2950 Cleveland Clinic Blvd.
Weston, Fla. 33331
877.463.2010
Endocrine Notes
Chairman, Endocrinology & Metabolism Institute
James B. Young, MD
Endocrine Notes updates physicians on clinical practices, advances and research from Cleveland Clinic’s
Managing Editor
Cora M. Liderbach
Endocrinology & Metabolism Institute. It is written for
Art Director
Mike Viars
purposes only. It does not provide a complete overview of
Marketing
Bill Sattin, PhD
Mary Anne Connor
physicians and should be relied upon for medical education
the topics covered and should not replace the independent
judgment of a physician about the appropriateness or risks
of a procedure for a given patient.
© 2011 The Cleveland Clinic Foundation
Leila Khan, MD
Specialty Interest(s): General endocrinology,
diabetes, calcium/bone disorders
Location(s): Main campus; Willoughby Hills
Family Health Center
Office: 216.445.1598 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Willoughby Hills, 440.943.2500
Leann Olansky, MD
Specialty Interest(s): Diabetes and diabetes complications, gestational diabetes, general endocrinology
Location(s): Main campus; Stephanie Tubbs Jones
Health Center
Office: 216.444.2642 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Stephanie Tubbs Jones Health Center, 216.767.4242
M. Cecilia Lansang, MD, MPH
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus
Office: 216.445.5246 | Fax: 216.445.1656
Appointments: 216.444.6568
Richard Shewbridge, MD
Specialty Interest(s): Endocrinology, diabetes, thyroid
disorders, hyperlipidemia, osteoporosis
Location(s): Medina
Office: 330.725.3713 | Fax: 330.725.2141
Appointments: 330.725.3713
Melissa Li-Ng, MD
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus; Solon Family Health Center
Office: 216.444.1949 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Solon, 440.519.6800
Vinni Makin, MD
Specialty Interest(s): General endocrinology,
diabetes, hirsutism, acne, thyroid disorders
Location(s): Main campus; Solon Family Health Center
Office: Main campus, 216.444.0539;
Solon, 440.519.6800 | Fax: Main campus,
216.445.1656; Solon, 440.519.6908
Appointments: Main campus, 216.444.6568;
Solon, 440.519.6800
Adi Mehta, MD
Specialty Interest(s): Diabetes mellitus, thyroid
disorders, gynecologic endocrinology, endocrine
complications of pregnancy, menopause, lipid
disorders, general and adolescent endocrinology
Location(s): Main campus; Beachwood Family
Health Center (Reproductive Endocrinology only)
Office: 216.445.5312 | Fax: 216.445.7261
Appointments: Main campus, 216.444.6568;
Beachwood, 216.839.3000
Guy Mulligan, MD
Specialty Interest(s): General endocrinology, diabetes
Location(s): Main campus; Twinsburg Family Health
and Surgery Center; South Pointe/Charles Miner
Medical Building
Office: 330.888.4000 | Fax: 330.963.4561
Appointments: Main Campus, 216.444.6568;
Twinsburg, 330.888.4000; South Pointe,
216.295.1010
Mario Skugor, MD
Co-director, Thyroid Center
Associate Director, Endocrinology Fellowship Program
Specialty Interest(s): Osteoporosis and calcium
metabolism, obesity and diabetes, multiple endocrine
neoplasia syndromes, thyroid disorders, thyroid cancer
Location(s): Main campus
Office: 216.445.0739 | Fax: 216.445.1656
Appointments: 216.444.6568
David Shewmon, MD
Specialty Interest(s): General endocrinology, diabetes,
high cholesterol, osteomalacia, osteoporosis, pituitary
tumors, thyroid conditions, thyroid cancer
Location(s): Wooster Family Health Center
Office: 330.287.4690 | Fax: 330.287.4876
Appointments: 330.287.4690
Mariam Stevens, MD
Specialty Interest(s): Diabetes, gestational diabetes,
goiter, Graves’ disease, Hashimoto’s disease, hirsutism,
hyperthyroidism, hypoglycemia, hypothyroidism,
polycystic ovary syndrome, thyroid disease,
thyroid nodule
Location(s): Independence Family Health Center
Office: 216.986.4000 | Fax: 216.986.4995
Appointments: 216.986.4000
Robert Zimmerman, MD
Director, Cleveland Clinic Diabetes Center
Vice Chairman, Department of Endocrinology, Diabetes
and Metabolism
Program Director, Endocrinology Training Program
Specialty Interest(s): Diabetes, thyroid disorders, growth
hormone in adults
Location(s): Main campus
Office: 216.444.9428 | Fax: 216.445.1656
Appointments: 216.444.6568
Department of Endocrine Surgery
Bariatric and Metabolic Institute
Eren Berber, MD
Director, Robotic Endocrine Surgery
Specialty Interest(s): Endocrine surgery (thyroid and
parathyroid), laparoscopic solid-organ surgery, advanced
laparoscopic surgery, laparoscopic radiofrequency
ablation of liver tumors, pancreatic neuroendocrine
tumors, robotic thyroid and parathyroid surgery,
laparoscopic and robotic adrenalectomy and liver surgery
Location(s): Main campus
Office: 216.445.0555 | Fax: 216.636.0662
Appointments: 216.444.6568
Kresimira (Mira) Milas, MD
Director, Thyroid Center
Specialty Interest(s): Endocrine surgery (thyroid
and parathyroid), thyroid cancer, multiple endocrine
neoplasia syndromes, hereditary thyroid disorders
Location(s): Main campus
Office: 216.444.4985 | Fax: 216.636.0662
Appointments: 216.444.6568
Jamie Mitchell, MD
Specialty Interest(s): Endocrine surgery (thyroid,
parathyroid and adrenal), laparoscopic solid organ
surgery, advanced laparoscopic surgery, laparoscopic
radiofrequency ablation of liver tumors
Location(s): Main campus; Independence Family Health
Center; Solon Family Health Center
Office: 216.445.9713 | Fax: 216.636.0662
Appointments: Main campus, 216.444.6568;
Independence, 216.986.4000; Solon, 440.519.6800
Joyce J. Shin, MD
Specialty Interest(s): Endocrine surgery (thyroid and
parathyroid), advanced laparoscopic surgery, laparoscopic
adrenalectomy, neuroendocrine tumors, thyroid/parathyroid
ultrasound, intra-abdominal ultrasound, laparoscopic
radiofrequency thermal ablation of liver tumors
Location(s): Main campus; Willoughby Hills
Family Health Center
Office: 216.636.9365 | Fax: 216.636.0662
Appointments: Main campus, 216.444.6568;
Willoughby Hills, 440.943.2500
Allan Siperstein, MD
Department Chair
Specialty Interest(s): Endocrine surgery (thyroid and
parathyroid), advanced laparoscopic surgery, laparoscopic
adrenalectomy, laparoscopic thermal ablation of liver
tumors, pancreatic endocrine tumors
Location(s): Main campus
Office: 216.444.5664 | Fax: 216.636.0662
Appointments: 216.444.6568
Christian Nasr, MD
Co-director, Thyroid Center
Specialty Interest(s): Thyroid nodules, thyroid
cancers, flushing syndromes
Main campus; Lorain Family Health and Surgery Center
(Thyroid cancer only)
Office: 216.445.1788 | Fax: 216.445.1656
Appointments: Main campus, 216.444.6568;
Lorain, 440.204.7400
Stacy Brethauer, MD
Specialty Interest(s): Bariatric surgery, laparoscopic surgery,
gastrointestinal surgery, hernia repair, endoscopy, surgery for
GERD, hiatal hernia, solid-organ endoluminal surgery,
single-incision laparoscopic surgery
Location(s): Main campus
Office: 216.444.9244 | Fax: 216.445.1586
Appointments: 216.445.2224
Derrick Cetin, DO
Specialty Interest(s): Bariatric medicine, medical weight
management, nutrition sciences, obesity management,
preoperative evaluation, diabetes care
Location(s): Main Campus
Office: 216.445.4255 | Fax: 216.636.1588
Appointments: 216.445.2224
Bipan Chand, MD
Specialty Interest(s): Advanced laparoscopy and endoscopy,
endoscopy in the obese patient, gastric surgery focusing on
reflux disease, hiatal hernia, bariatric operations and gastric
cancer, biliary and spleen surgery, natural orifice transluminal
endoscopic surgery (NOTES), endoluminal surgery
Location(s): Main campus
Office: 216.444.6668 | Fax: 216.445.1586
Appointments: 216.445.2224
Karen Cooper, DO
Specialty Interest(s): Bariatric medicine, family medicine,
kinesiology and nutrition sciences, exercise instruction
Location(s): Main campus
Office: 216.445.1114 | Fax: 216.445.1586
Appointments: 216.445.2224
Matthew Kroh, MD
Specialty Interest(s): Advanced laparoscopic surgery,
bariatric surgery, gastrointestinal surgery, endoscopy,
single-incision laparoscopic surgery
Location(s): Main campus
Office: 216.445.9966 | Fax: 216.444.2153
Appointments: 216.445.2224
Tomasz Rogula, MD, PhD
Specialty Interest(s): Advanced laparoscopic surgery,
bariatric surgery, gastrointestinal surgery, endoscopy,
single-incision laparoscopic surgery
Location(s): Main campus; Strongsville Family Health
and Surgery Center
Office: 216.445.0255 | Fax: 216.445.1586
Appointments: Main campus: 216.445.2224;
Strongsville: 440.878.2500
Philip Schauer, MD
Department Chair
Specialty Interest(s): Bariatric surgery, laparoscopic surgery,
gastrointestinal surgery, colon surgery, weight management,
hernia surgery, biliary surgery, surgery for GERD
Location(s): Main campus
Office: 216.444.4794 | Fax: 216.445.1586
Appointments: 216.445.2224
Visit clevelandclinic.org/EndoStaff for the most current staff listings and locations.
C l e v e l a n d C l inic R E SOUR C E G u i d e
Physician Directory
Referring Physician Center
CME Opportunities: Live & Online
View all Cleveland Clinic staff
For help with service-related issues,
online at clevelandclinic.org/staff.
information about our clinical special-
Outcomes Data
ists and services, details about CME
Cleveland Clinic’s Center for Continuing
Education’s website offers convenient,
complimentary learning opportunities,
from patient simulations, webcasts and
podcasts to a host of medical publications and a schedule of live CME courses.
Physicians can manage CME credits
using the myCME.com Web portal
available 24/7. Visit ccfcme.org.
View the latest clinical Outcomes
books from Cleveland Clinic’s Endocrinology & Metabolism Institute at
opportunities and more, email
refdr@ccf.org, or call 216.448.0900
or 888.637.0568.
clevelandclinic.org/quality/outcomes.
EMI Referrals
Endocrinology & Metabolism Institute
216.444.6568 or 800.223.2273, ext. 46568
Bariatric Surgery
216.445.2224 or 800.223.2273, ext. 52224
F o r Y o u r P a tient s
DrConnect is a secure online service providing our physician colleagues with real-time information about the
treatment their patients receive at Cleveland Clinic. To
receive your next patient report electronically, establish
a DrConnect account at clevelandclinic.org/drconnect.
Complimentary assistance for out-of-state patients
and families: 800.223.2273, ext. 55580, or email
medicalconcierge@ccf.org.
Complimentary assistance for national and international
patients and families: 001.216.444.8184 or visit
MyChart
®
Cleveland Clinic MyChart® is a secure, online personal healthcare management tool that connects patients to portions of
their medical record at any time of day or night. Patients may
view test results, renew prescriptions, review past appointments and request new ones. A new feature, Schedule My
216.445.2547 or 800.223.2273, ext. 52547
open schedule and make appointments online in real time.
Appointment, allows patients to view their primary physician’s
Patients may register for MyChart® through their physician’s
office or by going online to ccf.org/mychart.
Cleveland Clinic’s critical care transport teams and fleet of
mobile ICU vehicles, helicopters and fixed-wing aircraft serve
critically ill and highly complex patients across the globe. Transport is available for children and adults. To arrange a transfer
for STEMI (ST elevated myocardial infarction), acute stroke, ICH
(intracerebral hemorrhage), SAH (subarachnoid hemorrhage)
or aortic syndromes, call 877.379.CODE (2633). For all other
critical care transfers, call 216.448.7000 or 866.547.1467
or visit clevelandclinic.org/criticalcaretransport.
Cleveland Clinic’s Diabetes & Endocrinology Program is ranked 5th in the
nation in U.S.News & World Report’s annual America’s Best Hospitals survey.
Updates for physicians on practices, advances and research
from Cleveland Clinic’s Endocrinology & Metabolism Institute
clevelandclinic.org /ic.
Request Medical Records
Critical Care Transport Worldwide
Endocrine Notes
Medical Concierge
Global Patient Services
Track Your
Patient’s Care Online
The Cleveland Clinic Foundation
Endocrinology & Metabolism Institute
Endocrine Notes
9500 Euclid Avenue / AC311
Cleveland, OH 44195
11-END-008
In This Issue:
2New Entity: Primary Hyperparathyroidism with Normal PTH
4A Rare Case of Acromegaly Diagnosed During Pregnancy
6Robotic Approach Preferred for Adrenalectomy
8 STAMPEDE Substudy Asks Whether Gastric Bypass
Reverses Beta Cell Dysfunction
9STAMPEDE II Study Now Enrolling Patients
10Bariatric Surgery Now Standard Treatment for Morbidly
Obese Diabetic Patients
11Gastric Plication Holds Promise for Extreme Weight Loss
12Adult Growth Hormone Deficiency: Study Compares
Glucagon Stimulation Test to Insulin Tolerance Test
14Publications
18 Live and Online CME
19Current Clinical Trials
20Staff Directory
2011
C l e v e l a n d C l inic R E SOUR C E G u i d e
Physician Directory
Referring Physician Center
CME Opportunities: Live & Online
View all Cleveland Clinic staff
For help with service-related issues,
online at clevelandclinic.org/staff.
information about our clinical special-
Outcomes Data
ists and services, details about CME
Cleveland Clinic’s Center for Continuing
Education’s website offers convenient,
complimentary learning opportunities,
from patient simulations, webcasts and
podcasts to a host of medical publications and a schedule of live CME courses.
Physicians can manage CME credits
using the myCME.com Web portal
available 24/7. Visit ccfcme.org.
View the latest clinical Outcomes
books from Cleveland Clinic’s Endocrinology & Metabolism Institute at
opportunities and more, email
refdr@ccf.org, or call 216.448.0900
or 888.637.0568.
clevelandclinic.org/quality/outcomes.
EMI Referrals
Endocrinology & Metabolism Institute
216.444.6568 or 800.223.2273, ext. 46568
Bariatric Surgery
216.445.2224 or 800.223.2273, ext. 52224
F o r Y o u r P a tient s
DrConnect is a secure online service providing our physician colleagues with real-time information about the
treatment their patients receive at Cleveland Clinic. To
receive your next patient report electronically, establish
a DrConnect account at clevelandclinic.org/drconnect.
Complimentary assistance for out-of-state patients
and families: 800.223.2273, ext. 55580, or email
medicalconcierge@ccf.org.
Complimentary assistance for national and international
patients and families: 001.216.444.8184 or visit
MyChart
®
Cleveland Clinic MyChart® is a secure, online personal healthcare management tool that connects patients to portions of
their medical record at any time of day or night. Patients may
view test results, renew prescriptions, review past appointments and request new ones. A new feature, Schedule My
216.445.2547 or 800.223.2273, ext. 52547
open schedule and make appointments online in real time.
Appointment, allows patients to view their primary physician’s
Patients may register for MyChart® through their physician’s
office or by going online to ccf.org/mychart.
Cleveland Clinic’s critical care transport teams and fleet of
mobile ICU vehicles, helicopters and fixed-wing aircraft serve
critically ill and highly complex patients across the globe. Transport is available for children and adults. To arrange a transfer
for STEMI (ST elevated myocardial infarction), acute stroke, ICH
(intracerebral hemorrhage), SAH (subarachnoid hemorrhage)
or aortic syndromes, call 877.379.CODE (2633). For all other
critical care transfers, call 216.448.7000 or 866.547.1467
or visit clevelandclinic.org/criticalcaretransport.
Cleveland Clinic’s Diabetes & Endocrinology Program is ranked 5th in the
nation in U.S.News & World Report’s annual America’s Best Hospitals survey.
Updates for physicians on practices, advances and research
from Cleveland Clinic’s Endocrinology & Metabolism Institute
clevelandclinic.org /ic.
Request Medical Records
Critical Care Transport Worldwide
Endocrine Notes
Medical Concierge
Global Patient Services
Track Your
Patient’s Care Online
The Cleveland Clinic Foundation
Endocrinology & Metabolism Institute
Endocrine Notes
9500 Euclid Avenue / AC311
Cleveland, OH 44195
11-END-008
In This Issue:
2New Entity: Primary Hyperparathyroidism with Normal PTH
4A Rare Case of Acromegaly Diagnosed During Pregnancy
6Robotic Approach Preferred for Adrenalectomy
8 STAMPEDE Substudy Asks Whether Gastric Bypass
Reverses Beta Cell Dysfunction
9STAMPEDE II Study Now Enrolling Patients
10 Bariatric Surgery Now Standard Treatment for Morbidly
Obese Diabetic Patients
11 Gastric Plication Holds Promise for Extreme Weight Loss
12 Adult Growth Hormone Deficiency: Study Compares
Glucagon Stimulation Test to Insulin Tolerance Test
14 Publications
18 Live and Online CME
19 Current Clinical Trials
20 Staff Directory
2011